KEGG   Methylobacterium extorquens PA1: Mext_1870Help
Entry
Mext_1870         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1
Motif
Other DBs
NCBI-ProteinID: ABY30269
JGI: Mext1870
UniProt: A9W3W3
Position
2091306..2091887
Genome map
AA seq 193 aa AA seqDB search
MDATQIETWGFSRTEAADIVGMTSGQIGNYLVRYDLFPGKTKGKGHHVHFRLRDLMKLGA
VKALIENGLTPEQAAGALRGIQGPYGTLLHDGFGEDREPAFNYPGTLFFTRAADGKWIAA
DDPSKIVCILVRAWPIFDEIWPRIRAHILKDSVSAKPSYPGDAKVGLEKFEQGIEAIRAE
RWERQRRPETNDG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccacgcagatcgaaacatgggggttcagccggaccgaggcagctgacatcgtc
ggcatgacgagcggtcagatcggcaactatctggttcgctatgacctctttccggggaag
acaaagggtaagggacatcatgtccatttccggctgcgcgacctcatgaaactcggcgcc
gtgaaggcgctgatcgagaacgggcttacgcccgaacaggcagccggggcacttcgcggc
atccaaggcccatacggcactctgctgcacgatggtttcggtgaagaccgggaaccggcc
ttcaattatccagggactctgttctttacgcgtgctgctgatggcaagtggatcgcggcg
gacgatccaagcaagatcgtctgcatcttggttcgtgcgtggccgatcttcgacgagatc
tggccgcgaattcgggctcacatcctgaaagatagtgtctctgcaaagccgtcctatccc
ggcgacgctaaggtcgggctggagaaattcgaacagggcatcgaagctatacgcgctgag
cggtgggaaagacaaagaaggccagagactaacgacggctaa

DBGET integrated database retrieval system