KEGG   Methylobacterium extorquens PA1: Mext_1871Help
Entry
Mext_1871         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30270
JGI: Mext1871
UniProt: A9W3W4
Position
2092385..2092669
Genome map
AA seq 94 aa AA seqDB search
MMTAIDELWFMAHPERQYRLRRLTTAEIMARPVLPPPFHTVWAVIRHEPAQTEVLAARRS
VGPPTKDQDFELEWLFDFLSRPPEVAPTDDGGEA
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgcaatcgacgagctgtggttcatggctcacccagagcgccagtatcgccta
cgtcgcctgacgacagccgaaattatggcacggccagtcctgccgccgccgttccacacg
gtatgggccgtcatccgccacgagcccgcacagaccgaagtgctagctgcccgccgttcg
gtcgggcctccgaccaaggaccaggatttcgagctggaatggttgttcgacttcctgtcg
cgtccgccggaggtggcaccaactgatgacgggggtgaggcatga

DBGET integrated database retrieval system