KEGG   Methylobacterium extorquens PA1: Mext_1873Help
Entry
Mext_1873         CDS       T00640                                 

Definition
(GenBank) DnaB domain protein helicase domain protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase AAA AAA_16 CbiA HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ABY30272
JGI: Mext1873
UniProt: A9W3W6
Position
2092893..2094290
Genome map
AA seq 465 aa AA seqDB search
MTAGAAAPHSLDSEQALLGAILINGDAIDGARQHVQPEDFVEAVNGQIFEAMCARRDAGE
PIDRRMMLAVLGNTDLGGVTVGAYLGRLVTEATTVINAPGYARAIAQAARMRKVLETAQE
AVAAMTDGSLRDPAAHAAYMIEALDEVASAGLAEHVRRITLGKSTAGVLARVAETREGKK
RRGVSYGVPKLDAVTLGMRPGQFIVLAGRPAMGKTLTALHIAIAAARSGGAVGMFSLEME
ADELSERVLSALAYDPRAREPISYRDIAEARSLSDEALWRLEEAQKEAARIPLWIEPQAG
VTLSQIASRARQMRLMAERQGQPLAALVIDHIGLIRPSKRYSGNRVQEMTEISSGLKGLA
KELGVPVLGLSQLSREVERREDKRPILSDLRDSGSIEQDADVVLGLYRESYYLERKTDLT
DDEINRLARAQNILEIEILKQRGGPTLRIECFADLAANVLAEACL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgggggcagccgcaccacactcgctcgactccgaacaagcgctgctcggcgcg
atcctcatcaacggcgacgcgatcgatggggctcggcagcacgtccagcccgaggatttc
gtcgaggccgtcaacgggcagattttcgaggctatgtgcgcccgccgcgatgctggcgag
ccgatcgaccgccggatgatgctcgcggtgctcggcaacaccgacctcggcggcgtcacg
gtcggagcctacctcgggcggctggtgacggaggcgactaccgtcatcaacgcgcccggc
tacgcgcgtgccatcgcccaggccgcgcggatgcggaaagtcttagagaccgcgcaggag
gccgtcgccgccatgacggacggctcgctgcgcgacccggccgcccacgctgcctacatg
atcgaagccctggacgaggtcgcgagcgccggcctcgccgagcacgtgcgtcgcatcacg
ctcggcaagagcacggccggcgtgctcgcccgcgtcgccgagacccgggagggcaagaaa
cgccgcggcgtctcctacggcgtcccgaagctcgatgccgtgaccctcggcatgcggccg
ggccaattcatcgtgctcgccggtcgcccggccatgggcaagaccttgaccgccctccac
atcgcgatcgccgcggcgcgctccggcggcgccgttggcatgttctcactggagatggag
gccgacgagttgtccgagcgcgtcctgtcggcgctggcctacgacccccgcgcgcgcgag
ccgatcagctatcgcgacatcgccgaagctaggagcctgtctgacgaggcgctgtggcgg
ctcgaggaggcgcagaaggaagccgcccgcatcccgctctggattgagccgcaggccggc
gtgacgctgtcgcagatcgcatccagagcgcggcagatgcggcttatggccgagcgacag
gggcagccgctcgcggcgctggtcatcgaccacattggcctgatccgcccctcaaaacgc
tactcgggcaaccgggtgcaagagatgactgagatctcctcggggctgaagggccttgcg
aaagaactcggcgtgcccgtgctcggcctgtcgcagctcagtcgtgaggtcgagcggcgc
gaggacaagcggccaatcctgtccgatctacgcgattccggctccatcgagcaggacgcc
gatgtggtgctcgggctgtaccgcgagagctactaccttgagcgcaagaccgacctgacc
gacgacgagatcaaccgtctggcgcgggcgcagaacatcctcgagatcgagatcctgaag
cagcgcggtggaccaacactcaggattgagtgtttcgctgatctcgccgccaacgtgctg
gcggaggcctgcctgtga

DBGET integrated database retrieval system