KEGG   Methylobacterium extorquens PA1: Mext_1876Help
Entry
Mext_1876         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2096408..2096803
Genome map
AA seq 131 aa AA seqDB search
MQPHAGRSAIAENRFPHLTKAACGRCLIPFDRREGISVEQAAEIAGKSVRTLRLWCEQHQ
IGRRVGGGPWVVSRPALEMLLNDDQRALSAYLAGDRESPVVTGYFERVGLQHLPAKWGRH
VAAIAATATYP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccatgccggccgcagcgccattgccgaaaatcgcttcccgcacctcacaaag
gccgcttgcggccgctgcctgatcccgttcgatcgccgcgaaggcatttcggtcgagcag
gccgcggagatcgcaggcaagtcggtgcggaccctacgcctctggtgcgagcagcatcag
atcggacgtcgtgttggcggggggccgtgggtcgtcagccgcccggcgctcgagatgctc
ctgaacgacgatcaacgtgcgctctcagcttatttggccggcgaccgggagagcccggtt
gtcaccggctacttcgaacgggtcggcctgcagcacctgcccgcaaagtggggccggcac
gtcgcggcaatagcggcaacggcgacgtatccctaa

DBGET integrated database retrieval system