KEGG   Methylobacterium extorquens PA1: Mext_1877Help
Entry
Mext_1877         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR HTH_28 HTH_23 MerR_1
Motif
Other DBs
NCBI-ProteinID: ABY30276
JGI: Mext1877
UniProt: A9W3X0
Position
2097243..2097833
Genome map
AA seq 196 aa AA seqDB search
MQTEVKAAFARRHGVNRSTVQKWQDKGLLVIAPDGMVNVEATEWNLDQRPAKYRGGTAHR
PVRTAPRDVRTIPQEARTGPQDGPQTEEEPEGGLLIVLATLVGIVGKISAEAAVASGASM
RVAYALDSITTVHLWNEAERMLGIPPGSVSGFETMVDRRVVEPNWDALAAQASEPVDIDA
WDAFVAAHPMLQPPAT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgaggtgaaggccgcctttgctcggcgccacggggtgaaccgatccacggta
cagaagtggcaggacaagggcctcctcgtcatcgcgcccgacgggatggtcaatgtcgag
gccaccgaatggaacctcgaccagcggccggccaagtatcggggcggcacggcccaccgc
ccggtgcggacagcgccccgggacgtgcggacaattccgcaggaagcgcggacaggtccg
caggatggtccgcagaccgaggaagagccggagggtggcctcctcatcgtgctcgccacg
ctcgtcggcatagtcgggaagatcagtgccgaggccgccgtcgcgagcggcgcctcgatg
cgcgtggcctatgctctcgacagcatcacgaccgtccacctctggaacgaggcggagcgg
atgctcggcatcccgcccggcagcgtgtcaggcttcgaaaccatggtggatcggcgcgtg
gtcgagcccaattgggacgccctcgctgcgcaggcgagcgagccggtcgatatcgacgcc
tgggacgccttcgtagcagcccacccgatgttgcaaccgccggccacgtga

DBGET integrated database retrieval system