KEGG   Methylobacterium extorquens PA1: Mext_1879Help
Entry
Mext_1879         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2099224..2099472)
Genome map
AA seq 82 aa AA seqDB search
MPRYFLDFQDGALWLKDEEGQEYESLQAARDAAIAALPDVGREAPPRNGKRDFVAFVRDE
HGTQLCTVRLNLDAECRPESSG
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgctattttctcgattttcaggacggtgcactgtggctgaaggacgaggagggg
caggagtacgaaagcctgcaggccgcgcgtgacgcggcgatcgcggcattgccggatgtc
gggcgggaggctccgcctcggaacggtaagcgcgatttcgtagcctttgtccgcgatgag
cacggcacacagctctgcaccgtgcggctgaacctggacgcggagtgccgtcccgagagt
tcgggctga

DBGET integrated database retrieval system