KEGG   Methylobacterium extorquens PA1: Mext_1888Help
Entry
Mext_1888         CDS       T00640                                 

Definition
(GenBank) PAS sensor protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HWE_HK PAS_9 PAS PAS_4 PAS_3 PAS_8 HisKA_2 HATPase_c_2 Kdo THDPS_N_2
Motif
Other DBs
NCBI-ProteinID: ABY30287
JGI: Mext1888
UniProt: A9W3Y1
Position
2108114..2109094
Genome map
AA seq 326 aa AA seqDB search
MVDLRLLRAAVEASGEAILITSAELDEPGPRIEYANPAFTRMTGYAAHEVVGRTPRILQG
PRTERAALDRLRAALEAGDTAQAEAVNYRKDGSTYVVEWLITPVREADGRITHWVATQRD
VTDRRAYEDRQAMMVRELHHRVKNTLATVQAVLNATVRSSLSIPEFTRALSGRIASLART
HALITEDLAQAASFDGLLRAELDPYDERERLTLEGPAVMLPSELAVPVGMALHELTTNAL
RHGSLADPNGRLRVTWWIEEGATGRGLRWDWSEHDGPPAEHPTREGFGHRLLNKVLAVQT
GAEVDVAFAPDGLRVSIRMPLPEHRT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacctcaggctcttgcgcgccgcggtcgaggcttccggcgaggccatcctgatc
acctcggccgaactcgatgaaccggggccgcgcatcgagtacgccaaccccgcgttcact
cgcatgaccggctacgcggcgcacgaggtcgttgggcgcacgccgcgtatcctgcaaggg
ccgcgcacggaacgggccgcgctggaccgcctgcgggccgcactcgaagccggtgatacc
gcccaggccgaggcggtgaactaccgcaaggatggctcgacctatgtggtcgagtggctg
attacgccggtgcgcgaggccgacgggcgtattacgcactgggtcgcgacgcagcgcgac
gtgacggaccggcgtgcctacgaagaccgacaggccatgatggtgcgcgagttgcatcac
cgggtgaagaacacgctcgccaccgtccaggccgtgctgaacgcgaccgtgcgctcctct
ctgtccatcccggaattcacccgcgccttgtcggggcggatcgcctccctcgcccgcacc
cacgcgctgatcaccgaggaccttgcccaggcggcctccttcgacgggctgctgcgggcg
gagctcgacccctacgacgagcgcgaacgcctgacgctggaggggcccgcggtcatgctg
ccgtccgagcttgccgtaccggttggcatggccctgcacgagttgaccaccaacgcgctg
cggcacgggtcgctggcggatccgaacggccggcttcgtgtgacgtggtggatcgaggaa
ggggcgacggggcgcggcttgcgctgggactggagcgagcacgacgggccacctgccgag
catcccacgcgcgagggcttcggtcaccgcctgctcaacaaggtcctggccgtacaaacg
ggggcggaggtcgacgtcgccttcgcgccggatggcttgcgggtttctatccgaatgccg
ctgcccgagcaccgaacttga

DBGET integrated database retrieval system