KEGG   Methylobacterium extorquens PA1: Mext_1905Help
Entry
Mext_1905         CDS       T00640                                 

Definition
(GenBank) Recombinase
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2121934..2123691
Genome map
AA seq 585 aa AA seqDB search
MPGLRTFGRPMPKCYSYIRFSRPEQMRGDSLRRQTEAAEKWAAENGMVIDESLTDLGVSA
YRGLNRLKGALGKFLELVAGGQVPKGSYLIIESLDRFSREDALDVISEFSKVLRSGVTIV
TLLDGQVYSRERIKAEPMALFGSLMVMMRAHEESKTKGKRVGEAWEKKRKSASDAVLTAR
VPGWLQVVEDGGRRRIEFKPHGREVVRRIFADTVNGYGKLKVAQRLKEAGFETFEDGKTW
HGSYVQKVLRNRATFGEMQPYKRDEEGRRVPAGPPVKGYYPAAVSEADFMRASAALALRD
KSGGPREATGEANLLRNLARCTCGGRMRRENKGGKSSAWLVCAEASRGDCTNTRRWRLDL
AEEKLLGCSARIDFRKLLAAEGEKMDAPPTVADYEAKAAEVSKRLAAIMAVVEMGVTAYA
HRAVELQKESDEAEAELARVRRLGAIGAHQPTPEQRRRTLAELKARLAGATDAERADLRV
RLAQEVRAAFKEVTFGPDRITATYKGMVPFGKVLQPRDVTVLIHTENPDEIAEFQSAALE
MDEGNRRSGSVAEFARRQRARSGALENLEPKVDLLDEVFDPMPAV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
ttgccggggctccgcactttcggacgcccgatgcccaagtgctactcctacatccggttc
tcgcgtcccgagcagatgcgcggcgacagcttgcggcgccagaccgaagccgccgagaag
tgggccgccgagaacggcatggtcatcgacgagagcctgacggacctcggcgtcagcgcc
tatcgcggcctcaacaggctcaagggcgcgctcggaaagttcctcgaactcgtcgccggg
ggacaggtgccgaagggctcctacctgatcatcgagagcctggaccgcttcagccgcgag
gacgccctcgacgtcatcagcgagttctccaaggtcctgaggtcgggcgtcaccatcgtc
acgctgctcgacgggcaggtctactcccgcgagcggatcaaggccgagcccatggcgctg
ttcggctcgctcatggtgatgatgcgcgcccacgaggagagtaagacgaagggcaagcgg
gtcggggaggcctgggagaagaagcggaagtcggcctcggacgcggtgctgacggcgcgt
gtccccggctggttgcaggtcgtcgaggacggcggcaggcgacggatcgagttcaagccg
cacgggcgggaagtcgtccgccggatcttcgcggacacggtcaacgggtacggcaagctg
aaggtcgcccaacgcctcaaggaggccggcttcgagaccttcgaggacggcaagacctgg
catgggtcctacgtccagaaggtgctgcgtaaccgggcgaccttcggcgagatgcagccc
tacaagcgggacgaggaaggccgcagggtgccggccggtcccccggtcaagggatactac
cccgcagccgtcagcgaggcggacttcatgcgcgcctcggcggcgctggccctgcgcgac
aagtccggcgggccgcgcgaggccacgggcgaggcaaacctcctgcgcaacctcgcccgc
tgcacctgcggcggccggatgcggcgcgagaacaagggcgggaagagctcagcgtggctt
gtctgcgccgaggcgtcccggggcgactgcaccaacacgcgtcgttggcgcctcgacctc
gccgaggagaagctcctcggctgctcggcccgcatcgattttcgcaagctcctcgccgcc
gagggcgagaagatggacgcgcctccgacggtcgccgattacgaggccaaggccgcggag
gtttccaagcggctcgccgccatcatggccgtcgtcgagatgggtgtgaccgcgtatgcg
caccgcgccgtcgagctgcagaaggagtccgacgaggccgaggccgagctcgcccgcgtc
cggcggctcggggccatcggtgcgcaccagccgaccccggagcaacggcggcggaccctg
gcggaactcaaggccaggctcgcgggtgcgaccgacgcggagcgggccgacctacgcgtc
cggctcgcccaggaggtacgggcggcgttcaaggaggtcactttcgggccggaccggatc
acggcgacctacaagggaatggtacccttcggtaaggttctgcagccgcgcgacgtgacg
gtcctgatccacaccgagaacccggacgagatcgccgaattccagtcggccgccctggag
atggacgagggcaaccggcgcagcgggtcggtcgccgagttcgcccggcgccagcgggcg
cgctcgggtgccttggagaacttggaaccgaaggttgaccttcttgacgaggtgtttgac
ccgatgcccgccgtatga

DBGET integrated database retrieval system