KEGG   Methylobacterium extorquens PA1: Mext_1908Help
Entry
Mext_1908         CDS       T00640                                 

Definition
(GenBank) regulatory protein ArsR
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2126729..2127091
Genome map
AA seq 120 aa AA seqDB search
MMDETQALAAFLALGQEHRLRLVRALVTAGPGGLASGVLADAVGVSAATVSHHLKELSHA
GLVTSRREGRSIIYSAAYPALSDLVQFLMRDCCQGHPEVCAPALAALTACDCTTGDTLHA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgagacgcaagccctcgccgcctttctggcccttggacaggaacaccgcctt
cgcctggtgcgggcgctcgtgaccgccgggcccggagggctggcctccggagtcctggcc
gacgcggtcggcgtgtccgcggccaccgtgtcccatcacctgaaggagctgagccacgcc
gggctggtcacctcccggcgcgagggccgctcgatcatctacagcgccgcctacccggcg
ctgtcggacctcgtccagttcctcatgcgcgactgctgccagggccatccggaggtctgc
gccccggccctcgccgcgctcaccgcctgcgattgcaccaccggggacaccctccatgcc
tga

DBGET integrated database retrieval system