KEGG   Methylobacterium extorquens PA1: Mext_1909Help
Entry
Mext_1909         CDS       T00640                                 

Definition
(GenBank) low molecular weight phosphotyrosine protein phosphatase
  KO
K03741  
arsenate reductase [EC:1.20.4.1]
Organism
mex  Methylobacterium extorquens PA1
Brite
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     Mext_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2127084..2127611
Genome map
AA seq 175 aa AA seqDB search
MPEPVYNVLFLCTGNSARSILAEAMLNKEGAGRFRAFSAGSQPKGEPHPLALQVLRESDH
PTEGLRSKSWGEFAGPDAPVMDFVFTVCDNAAGEACPFWPGQPVTAHWGIEDPAAAEGSE
MERKRAFVTAQRYLKNRISALVALPLGSLDQVALSSKVREIGQLAGATSARPEVA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgtctacaacgtcctgttcctctgtaccggcaactcggcgcgctctatc
ctggccgaggcgatgctcaacaaggagggggccggccgcttccgcgccttctcggccggc
agccagccgaagggcgagccgcacccgctggcgctgcaggtgctgcgggagagcgaccat
ccgaccgagggcctgcgttcgaagtcctggggcgaattcgccggaccggacgcgccggtc
atggatttcgtcttcaccgtctgtgacaacgccgccggtgaggcctgcccgttctggccc
ggccagccggtgaccgcgcactggggcatcgaggaccccgccgcggcggagggctcggag
atggagcgcaagcgcgccttcgtcaccgcgcagcgctacctcaagaaccgcatctcggcc
ctcgtcgccctgccgctcggcagcctcgaccaggtcgccctatcttcgaaggtccgcgag
atcggccagctcgccggcgcgacctcggcccggccggaggtcgcgtga

DBGET integrated database retrieval system