KEGG   Methylobacterium extorquens PA1: Mext_1914Help
Entry
Mext_1914         CDS       T00640                                 

Definition
(GenBank) transcriptional regulator, ArsR family
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2131177..2131494
Genome map
AA seq 105 aa AA seqDB search
MNVEQAAKQLESLGSPARLRIYRALVRAGHAGLPVRQLQERVGIPAASTLSHHLHRLILT
GLVTQERQATTLICRAVYPAMNALVGYLSDECCADEACSDKGEAA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgaacaagccgccaagcagcttgagtccttgggcagcccggcccggctccgg
atctaccgggcccttgtccgggccggccatgcgggactgccggtgcgccagttgcaggag
cgggtcggcatccccgccgcctcgacgctgtcgcatcacctgcaccggctgatcctcacc
gggctggtcacccaggagcggcaggcgaccaccctgatctgccgtgccgtctaccccgcg
atgaacgcgctcgtcggatacctgtcggacgagtgctgcgccgacgaggcctgctccgac
aagggcgaggcagcctga

DBGET integrated database retrieval system