KEGG   Methylobacterium extorquens PA1: Mext_1921Help
Entry
Mext_1921         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2139229..2139525
Genome map
AA seq 98 aa AA seqDB search
MRMETAREALAQGRCLEVRYDDYARVVEVHACGFTGQGHAVMRVWQVRGGSVSGERTGWK
LLRLDEALALAVTGEASEAPRRGYRRGDAGMARIVAQV
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggagacggcccgggaagcgctggcgcaggggcggtgcctggaggtccggtac
gacgactacgcccgcgtggtggaagtccacgcctgcggcttcaccgggcagggccatgcg
gtgatgcgcgtctggcaggtgcggggtggcagcgtgagcggcgagcgcaccggctggaag
ttgctgcggctcgacgaggcgctcgccttggcggttacgggggaggcgtcggaggcgccg
cggcggggctatcgccgcggggacgcgggcatggctcgcatcgtcgcgcaggtctga

DBGET integrated database retrieval system