KEGG   Methylobacterium extorquens PA1: Mext_1931Help
Entry
Mext_1931         CDS       T00640                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT SPOR SLT_2
Motif
Other DBs
NCBI-ProteinID: ABY30330
JGI: Mext1931
UniProt: A9W424
Position
complement(2147863..2148849)
Genome map
AA seq 328 aa AA seqDB search
MPRKRAAIPFPDRRPKSAAVSRLALVLLPAALAVLAGPSRAAPSPESETVEQALCRLIED
SAKARKLPVPFLTRLIWRESAFRVGVVSPAGAQGVAQFMPGTAKDRGLTDPFDPEQAIPH
AAHFLADLKRQFGNLGLAAAAYNGGPGRVSAWLAGSGGLPAETRAYVIGITGRPAEDWRP
NANVEMPEGADPSAKKPEGKKAEGQPEDKPPPPEAETQSCLQVTAALRIPSRGDRFALSV
EGGPAAPWGVQLAGNFSKSLALASFQRARVRYTSVIGEVRPMIVGTRLRFRGTRTFYRVR
IPAESRNAADGLCQKIRGVGGACIVLRT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcggaagcgggcagccatccccttcccggaccggcgccctaaatcagccgccgtg
tctcgtctcgccctcgttcttctgccggccgccctcgccgtgctcgccggtccctcgcgt
gcggccccctcgcccgagagcgagacggtggagcaggcgctctgccgtctgatcgaggac
tcggccaaggcgcggaagctgccggtgccgttcctgacgcgcctgatctggcgcgagagc
gcgtttcgcgtgggcgtggtgagcccggccggtgcacagggcgtggcgcagttcatgccg
ggcacggccaaggatcgcgggctgaccgatccgttcgaccccgaacaggcgatcccgcac
gcggcgcatttcctggccgacctcaagcggcagttcggcaatctcgggctggccgcggcg
gcctataacggcgggccggggcgggtctcggcctggctcgccggcagcggcggcctgccc
gccgagacgcgggcctacgtcatcggcatcaccggccgcccggcggaggattggcggccg
aacgccaatgtcgagatgccggagggagccgatccgtcggcgaagaagcccgagggcaaa
aaggccgagggacaacccgaggacaagccgcccccgccggaggccgagacgcagagctgc
cttcaggtcactgccgccctgcgcatcccgtcgcgcggggaccgcttcgccctgtccgtc
gaggggggcccggccgcgccctggggcgtgcagctcgccggcaacttctcgaagtcgctg
gcactcgcgagcttccagcgggcgcgggtgcgctacaccagcgtgatcggcgaggtgagg
ccgatgatcgtcggcacccgcctacgctttcgtggcacccgcaccttctaccgggtgcgc
atcccggccgagagccggaacgcggccgacggcctctgccagaagatccgcggtgtcggc
ggcgcctgcatcgtcctgaggacataa

DBGET integrated database retrieval system