KEGG   Methylobacterium extorquens PA1: Mext_1940Help
Entry
Mext_1940         CDS       T00640                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mex  Methylobacterium extorquens PA1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2160291..2161316
Genome map
AA seq 341 aa AA seqDB search
MTEPTQSGPFPAGPVLITGASGFLGAALVDVFRAAGFRVRITVRASSPRTNLIWPDVEIV
EADMRDRAAVASAMRGQRYLVHAAADYRLWAPDMEEIVRTNRDGTRILMEEALKAGVERI
VYTSSVATIKPHDDGTPADETRPLTPETAIGAYKRSKVVAERVVDEMVARDGLPAVIVNP
STPIGPRDVKPTPTGRIILDAAQGKIPAFVDTGLNLAHVDDVAAGHLLALRKGRIGEHYI
LGGEDVMLAQMLADIAAIVGRKAPTTRLPYAVIYPIAFISEQIARVTGKAPLATIDGVRM
SKYRMFFSDAKARAELGYSARPYRRGLEDAIAWFRQAGYMK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccgacccaaagcggcccgttcccagcggggccggtgttgatcaccggtgcc
agcggcttcctcggagccgccctggtggacgtcttccgcgcggccggcttccgcgtgcgc
atcaccgtgcgtgcctcctcgccccgcaccaacctgatctggcccgatgtcgagatcgtc
gaggccgacatgcgcgaccgggcggcggtggcgagcgccatgcgcggccagcgctacctc
gtccacgcggcggccgattaccggctgtgggcgccggacatggaggagattgtccgcacc
aaccgcgacggcacgcgtatcctgatggaggaggcgctcaaggctggcgtggagcggatc
gtctacacatcgagcgtcgcgaccatcaagccgcacgacgacggcacccccgccgacgaa
acccggccgctgacgccggagaccgccatcggcgcctacaagcgcagcaaggtcgtggcc
gagcgcgtggtcgacgagatggtggcccgtgacggcctgcccgccgtcatcgtgaacccc
tcgaccccgatcggcccgcgcgacgtgaagccgacgccgaccggccgcatcatcctcgac
gcggcgcagggcaagatcccggccttcgtcgataccggcctcaacctcgcccatgtcgac
gacgtcgccgcgggccatctcctggccctgcgcaagggccggatcggcgagcactacatc
ctcggcggcgaggacgtgatgctggcgcaaatgctcgccgacatcgccgccatcgtcggc
cgcaaggcgccgacgacgcggctgccctatgccgtgatctacccgatcgccttcatctcc
gagcagatcgcgcgggtgaccggcaaggcgccgctcgccaccatcgacggcgtgcgcatg
tcgaagtaccggatgttcttctccgacgccaaggcgcgggcggaactcggctattccgcg
cggccctaccgccggggccttgaggatgccatcgcgtggttccgtcaggcggggtacatg
aaatga

DBGET integrated database retrieval system