KEGG   Methylobacterium extorquens PA1: Mext_2030Help
Entry
Mext_2030         CDS       T00640                                 

Definition
putative ferredoxin-NAD reductase component
Organism
mex  Methylobacterium extorquens PA1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2265275..2266216)
Genome map
AA seq 313 aa AA seqDB search
MRAPTSARCSLVVNGQPLRVSPGDTSLETALADGMIGPMNGLLGQGPGPASRRLPVRARR
AEAVTLSAPDPDATIRPVKTPVRTLARRTGSIDSITALAPRVLQVVATLERRLPFEPGDQ
VVVTLEGGHPVTLTPTLGVEGGAELNELVFHVRGESAEDLTALFGCPVEPGRAVKVKGPV
GNGTYRPGGGRLVLVAAETGFAGIWAIARAARYIEPAREICLVVGARDPLDLYMRPSLEW
LRATGVTRITLAADRHRQRGPDVRPGPLTAHIPSLRTTDVVHASGCPSTLGAVEVLAAAA
GARFYPIPLEPGA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctcccacgagcgcccgttgttcgcttgtcgtcaacggccagcccctgcgggtc
tccccgggcgacacttccctggagaccgcgctggcggacgggatgatcggcccgatgaac
gggctgctcggccagggccccggcccagcctcacggcggctccccgttcgagcgcggcgg
gcggaggcggtgacgctgtccgcacccgatccggacgcgacgatccggccggtcaagacg
ccggtccggacgctggcgcgccgcaccggcagcatcgactccatcacggcgctggcgccg
cgggtccttcaggtggtcgcaaccctggagcgccggcttcctttcgagccgggcgaccaa
gtcgtcgtcacgctcgaaggcgggcacccggtcacgctcacgccgacgctcggcgtcgag
ggcggggcggagttgaacgaactcgtcttccacgtgcgcggcgagagcgcggaggatctc
accgccctgttcggctgcccggtcgagcccggccgcgcggtgaaggtgaagggtccggtc
ggcaacggcacctatcggcccggcggcggccgcctcgtgctggtggcggcggagaccggg
ttcgccggcatctgggcgatcgcccgcgccgcgcgctacatcgagccggcccgcgagatc
tgcctcgtggtcggcgcgcgcgatcccctcgatctctacatgcgcccgtcgctcgaatgg
ctgcgcgccaccggcgtcacccgcatcacgctggccgctgaccgccaccgccagcggggg
cccgacgtgcgccccggcccgctcaccgcccatatcccgagcctgcggaccaccgacgtg
gtgcacgcctccggctgcccctcgaccctcggtgcggtggaggtcctggccgcggcggcg
ggggcgcggttctatccgatcccgcttgaaccgggggcgtag

DBGET integrated database retrieval system