KEGG   Methylobacterium extorquens PA1: Mext_2030Help
Entry
Mext_2030         CDS       T00640                                 

Definition
(GenBank) putative ferredoxin-NAD reductase component
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: ABY30426
JGI: Mext2030
UniProt: A9W4C0
Position
complement(2265275..2266216)
Genome map
AA seq 313 aa AA seqDB search
MRAPTSARCSLVVNGQPLRVSPGDTSLETALADGMIGPMNGLLGQGPGPASRRLPVRARR
AEAVTLSAPDPDATIRPVKTPVRTLARRTGSIDSITALAPRVLQVVATLERRLPFEPGDQ
VVVTLEGGHPVTLTPTLGVEGGAELNELVFHVRGESAEDLTALFGCPVEPGRAVKVKGPV
GNGTYRPGGGRLVLVAAETGFAGIWAIARAARYIEPAREICLVVGARDPLDLYMRPSLEW
LRATGVTRITLAADRHRQRGPDVRPGPLTAHIPSLRTTDVVHASGCPSTLGAVEVLAAAA
GARFYPIPLEPGA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctcccacgagcgcccgttgttcgcttgtcgtcaacggccagcccctgcgggtc
tccccgggcgacacttccctggagaccgcgctggcggacgggatgatcggcccgatgaac
gggctgctcggccagggccccggcccagcctcacggcggctccccgttcgagcgcggcgg
gcggaggcggtgacgctgtccgcacccgatccggacgcgacgatccggccggtcaagacg
ccggtccggacgctggcgcgccgcaccggcagcatcgactccatcacggcgctggcgccg
cgggtccttcaggtggtcgcaaccctggagcgccggcttcctttcgagccgggcgaccaa
gtcgtcgtcacgctcgaaggcgggcacccggtcacgctcacgccgacgctcggcgtcgag
ggcggggcggagttgaacgaactcgtcttccacgtgcgcggcgagagcgcggaggatctc
accgccctgttcggctgcccggtcgagcccggccgcgcggtgaaggtgaagggtccggtc
ggcaacggcacctatcggcccggcggcggccgcctcgtgctggtggcggcggagaccggg
ttcgccggcatctgggcgatcgcccgcgccgcgcgctacatcgagccggcccgcgagatc
tgcctcgtggtcggcgcgcgcgatcccctcgatctctacatgcgcccgtcgctcgaatgg
ctgcgcgccaccggcgtcacccgcatcacgctggccgctgaccgccaccgccagcggggg
cccgacgtgcgccccggcccgctcaccgcccatatcccgagcctgcggaccaccgacgtg
gtgcacgcctccggctgcccctcgaccctcggtgcggtggaggtcctggccgcggcggcg
ggggcgcggttctatccgatcccgcttgaaccgggggcgtag

DBGET integrated database retrieval system