KEGG   Methylobacterium extorquens PA1: Mext_2265Help
Entry
Mext_2265         CDS       T00640                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mext_2265
Enzymes [BR:mex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mext_2265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2511728..2512537)
Genome map
AA seq 269 aa AA seqDB search
MYAKPDSTTLKARLAKAGDAMDAALKSLSYGMSDDERRMSAVGLQGMRGANDPGRPDITP
DIAPLPESAQRVPNEVALGRPSRQEAEAAVRTLLRWAGDDPTREGLIETPARVVKAYEQI
FGGYRADADALLERVFEEVEGYSDAVLVRDIPFYSHCEHHMVPFMGLAHIAYYPTKGVVG
LSKLARVVDAFARRLQTQETMTAQIADTIESILQPRGCAVMIEAEHLCMAMRGVQKAGVS
TITTQFRGVYKNDASEQVRFLTFVRNQKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccaagcccgacagcaccaccctgaaggcgcgtttggcgaaggccggagatgcc
atggatgccgctctcaaatccctgtcctacggcatgagcgacgacgaacgacgcatgagt
gccgtgggcctgcaaggaatgcgcggcgccaacgatccgggccgtcccgacatcaccccc
gacatcgcgcccctgcccgaatcggcccagcgggtgccgaacgaggtggcgctcggccgt
ccgagccggcaggaggcggaggccgccgtgcgcacgcttctgcgctgggccggcgacgac
ccgacccgcgaagggctgatcgagacccccgcccgcgtggtgaaggcctacgagcagatt
ttcggcggctatcgcgccgacgccgacgcgctgctggagcgggtgttcgaggaggtcgag
ggctattccgacgccgtgctggtgcgcgacatcccgttctactcccattgcgagcaccac
atggtgccgttcatggggttggcccacatcgcctactaccccaccaagggcgtggtcggc
ctctccaagctcgcccgcgtggtcgatgccttcgcccgtcgcctgcagacgcaggagacc
atgacggcgcagatcgccgacacgatcgagagcatccttcagccccgcggctgcgccgtg
atgatcgaggccgagcatctctgcatggcgatgcgcggcgtgcagaaggccggcgtctcc
accatcaccacgcagttccgcggcgtctacaagaacgatgcgtccgagcaggtccgcttc
ctgaccttcgttcggaaccagaagggttga

DBGET integrated database retrieval system