KEGG   Methylobacterium extorquens PA1: Mext_2357Help
Entry
Mext_2357         CDS       T00640                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mex00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2609239..2610246
Genome map
AA seq 335 aa AA seqDB search
MVLTRFPRVALTDGPTPIRSLDRLSTHLGPELNGVRLFVKRDDIGPVGLGGNKLRKLEFL
LGQALAERADTVITVGALQSNHARLTAASAARMGLACELFLTRSVPREDADYTANGNRLL
QDLFGAHVHLLPGEADSLAQAEARAEELRAEGRRVHVFPSGGSSPLGCLGYAACAAEILE
QAANLGLAFARIVVPNGSSGTHAGLAAGLAAAGRDPHLAQSYTVLAPEPEATAATLARAR
DTLALIDGSQTLSDDAIRVDGAHRGLGYGIPTEGMREAVRLMARTEGLLLDPVYSGKAFA
GLLHDVRAGRYERGAAVLFVMTGGVPGLFAYRSEF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggttctcacccgcttcccccgtgtcgcgctcaccgacgggccgacgccgatccgctcc
ctcgaccgtctctcgacccatctcgggcccgagctgaacggcgtccgcctgttcgtgaag
cgcgacgacatcggcccggtgggtttgggcggcaacaagctgcgcaagctcgaattcctg
ctcggtcaggcgctggcggagcgggccgacacggtgatcaccgtcggtgcgctgcaatcg
aaccacgcccggctcaccgccgcctccgccgcgcggatggggctcgcctgcgaactgttc
ctcacccgcagcgtcccgcgggaggacgccgactacacggccaacggcaaccggctgttg
caggatctgttcggcgcccatgtgcacctgctgccgggcgaggcggattcgctggcgcag
gccgaggcgcgggcggaggagttgagggccgaggggcggcgcgtccacgtcttcccctcc
ggcgggtcgagcccgctcggctgtctcggctacgcggcctgcgccgccgagatcctggag
caggcggccaatctcggcctcgccttcgcccgcatcgtcgtgccgaacggcagctccggc
acccatgcggggctcgccgccggcctcgccgccgccggccgcgatccgcatctggcccaa
tcctacacggtgctcgcccccgagcccgaggcgacggccgcaacgctggccagggcccgc
gacaccctcgcgctgatcgatggcagccagacgctctccgatgacgccattcgcgtggac
ggcgcccatcgcgggctgggctacggcatcccgaccgagggcatgcgcgaggcggtgcgg
ctgatggcccgcacggaaggactgctgctcgaccccgtctacagcggcaaggcgttcgcc
gggctgctccacgacgtgcgcgccggccggtacgagcgcggcgcggcggtgctgttcgtg
atgaccggcggcgtgccggggttgtttgcctatcggagcgagttttag

DBGET integrated database retrieval system