KEGG   Methylobacterium extorquens PA1: Mext_2375Help
Entry
Mext_2375         CDS       T00640                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mext_2375
   00330 Arginine and proline metabolism
    Mext_2375
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mext_2375
Enzymes [BR:mex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Mext_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2625761..2626690
Genome map
AA seq 309 aa AA seqDB search
MPDLDSIVKDIAAEMRARPDRGAVASYIPELARVDAQGFGLVVIDGEGRVAAGGDADTPF
SIQSISKVFTLTLALGMVGDRLWRRVGREPSGSPFNSIVQLEREHGIPRNPFINAGAIAV
TDLILSGHQPREALGEILRFMQFVAQDDSITIDERVAASEKRTGFRNAALANYMRSFDVI
ENPVDYTLGVYFHHCAIAMTCRQLATAGLFLAYSGHHPLAGHSVISAERARRINAIMLTC
GHYDGSGDFAYRVGLPGKSGVGGGILAVAPGKASICVWSPGLDAAGNSHLGRIALEMLVK
RTGWSIFGV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgatctcgacagtatcgtcaaagacatcgccgcggagatgcgggcccggcccgat
cgcggcgcggtggcgagctacatccccgaactggcccgtgtcgacgctcaaggcttcggc
ctcgtcgtgatcgacggcgaggggcgggtcgcggccgggggggacgccgacactcccttc
tcgatccagagcatctccaaggtcttcaccctgacgctagccctcggcatggtcggcgac
cggctctggcgccgggtcggccgcgagccctcgggcagcccgttcaactccatcgtgcag
ttggagcgggaacacggcatcccgcgcaatcccttcatcaacgccggcgccatcgccgtc
accgacctgatcctgtcgggccatcagccgcgggaggcgttgggcgagatcctgcgcttc
atgcagttcgtggcgcaggacgacagcatcaccatcgacgagcgcgtggcggcttccgag
aagcgcacgggcttccgcaacgcggcgctcgccaactacatgcgctccttcgacgtgatc
gagaatccggtcgattacacgctgggcgtctacttccatcactgcgccatcgcgatgacc
tgccgccaactcgcgaccgccgggctgttcctggcctattccgggcaccatccgctggcc
gggcactcggtgatctcggccgagcgggcgcggcgtatcaacgccatcatgctgacctgc
ggccactacgacggctcgggcgatttcgcctaccgcgtcggcctgccgggcaagagcggc
gtcggcggcggcattttggccgttgcaccgggcaaggcctcgatctgcgtctggtcaccg
gggctggacgcggccggcaattcccatctcgggcgtatcgccttggagatgctggtgaaa
cgcactggctggtcgatttttggggtgtga

DBGET integrated database retrieval system