KEGG   Methylobacterium extorquens PA1: Mext_2505Help
Entry
Mext_2505         CDS       T00640                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mext_2505
Enzymes [BR:mex01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mext_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2806761..2807774
Genome map
AA seq 337 aa AA seqDB search
MPAFPFTAIVAQEEMKRALLIAAVDPSVGGVLVFGDRGTGKSTAVRALAALLPNIRAVAG
CPYSCSPDSPAEACPHCARGRGKSHQIPVPVVDLPLGATEDRVVGALDLERALTKGEKAF
EPGLLARANRGFLYIDEANLLEDHLVDLLLDVAASGVNTVEREGLSLRHPARFVLVGSGN
PEEGELRPQLLDRFGLACEVTTPTDIATRIEVVRRRDAYERDGEAFCAAQGKAEKALQKT
ILAARERLGSVSVPDAVLENAARLCLALGTDGLRGELTLMRTARALAALEGADIVSVAHL
RQVAPSALRHRLRRNPLDESGSTARVARAVEEVLGAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcctttcccttcaccgccatcgtcgctcaggaggagatgaagcgggcgctgctg
atcgccgcggtcgatccgtcggtcggcggcgtcctcgtcttcggtgaccggggtaccggc
aagtccacggcggtgcgggccctcgcggcgctgctgccaaatatccgggcggtcgccggc
tgtccctattcctgctcgcccgacagtccggccgaggcctgcccgcactgcgcgcggggg
cggggaaagagccaccagatcccggtgccggtggtcgatctgccgctcggcgccaccgaa
gaccgggtggtcggcgcgctcgatctggagcgggcgctgacgaagggggaaaaggcgttc
gagccgggcctgttggcgcgggctaaccgcggcttcctctacatcgacgaagccaatctg
cttgaggaccatctcgtggacctcctgctcgacgtggcggcctccggcgtcaacaccgtc
gagcgcgagggcctgtcgctgcgccatccagcccgcttcgtcctcgtcggcagcggcaac
ccggaggagggggagctgcgtccgcagcttctcgaccgcttcggcctcgcctgcgaggtg
acgacaccgaccgacatcgccacgcgcatcgaggtggtgcggcggcgcgacgcctacgag
cgcgacggcgaggcgttctgcgccgcgcaagggaaggctgaaaaagcgctccagaagacg
atcctcgcggcccgcgagcgtctcggcagcgtgagcgtgcccgatgcggttctggagaac
gcagcccggctctgcctcgcgcttggcaccgacggcctgcgcggcgaactcacgctgatg
cgcaccgcccgggcgctcgccgccctcgaaggtgcggacatcgtctcggtcgcgcatctc
agacaggtggcgccgagcgcgcttcgtcaccgcctacgccgcaacccgctcgacgagtcg
ggctccacggcgcgcgtggcgcgggccgtggaggaggtgctgggggccgggtga

DBGET integrated database retrieval system