KEGG   Methylobacterium extorquens PA1: Mext_2714Help
Entry
Mext_2714         CDS       T00640                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mext_2714
Enzymes [BR:mex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mext_2714
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mext_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3043000..3045354
Genome map
AA seq 784 aa AA seqDB search
MTALDEKAAARNEGQAAANVPNRSGSTEAPRAPRSSDALGGEGAPRVGRSASQARDGHLH
PDAIAAVMAADHGDAFGVLGPHQVAPGTWEVRAILPEAKAARLVTGGQSIAFERVHPDGF
YVASVKSEGRPLYEIEVEAWDGTSTRRHDPYGFGPSLEQSEIDGLRLIGSNLVYRVLGAH
AGELDGIAGFRFAVWAPNARRVSVVGDFNDWDGRRHPMRLWLNGGVWELFVPGLKAGQNY
KFEIRGPDGSVLPLKADPVAFRAQHPPQTASVLQGLNEPQWNDAAWMDTRGEKDPRHAAM
SVYEVHLGSWARVPDEGNRYLTYKELSDRLIPYVKDLGFTHIELLPITEYPFDGSWGYQP
VSLFAPTSRFGTPDDFVDFVNAAHAAGIGVMLDWVPGHFPLDAHGLGLFDGTHLYEHADP
RQGFHQDWGTYIYNFGRVEVSAFLTANARFWLEHYHLDGLRVDAVASMLYLDYSRRAGEW
IPNQYGGNENLDAINFLRKTNEATYSHAPGTITVAEESTSWPGVSHPTYTGGLGFGFKWN
MGWMHDTLKYMSEDPIHRRYHHHNLTFGLLYAFSENFVLPLSHDEVVHGKGSLLGKMPGD
RWQKFANLRAYFGFMWGHPGKKLLFMGGEFGQEREWNHNQSLDWHLLDDPLHGGVKDLIR
DLNHVYTSTPALYSRDVEASGFQWLVADDSDNSVIAWARKGKAEGEVAIVVSNFTPVPRE
GYRVGVPTAGFYREAINSDAERYGGSNVGNMGGVQSQAEQSHGQPHSLSLTLPPLSTLIL
IREG
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgacggctctggacgagaaggccgcggctcgtaacgaggggcaggcggccgccaacgtc
ccgaacaggtcaggctcgaccgaggcgccgcgcgcgccccggtcgtcggatgcgcttggc
ggcgagggggctccccgtgtgggccgctccgcctcgcaagcgcgcgatggccacctccat
cccgatgccattgcggccgtgatggcggccgatcacggcgacgcgttcggcgtcctcggg
ccgcatcaggttgcgcccggtacgtgggaggtccgtgcgatcctgccggaggcgaaggca
gcgcgcctcgtcacgggcgggcagagcatcgcgttcgaacgcgttcatcccgacgggttc
tacgtcgcgagcgtgaagagcgaaggtcgacccctctacgaaatcgaggtcgaggcctgg
gacggcaccagcacccgccgtcacgatccctacggtttcggcccctcgctcgaacagagc
gagatcgacggcttgcggctgatcggcagcaatctcgtctaccgcgttctcggtgcccat
gcgggcgaactcgacggcatcgccgggttccgcttcgcggtctgggcgccgaatgcccgc
cgcgtcagcgtcgttggcgatttcaacgattgggacggccggcgtcatccgatgcggctg
tggctcaacggcggcgtctgggagctgttcgtgccgggtctcaaggccgggcagaactac
aagttcgagatccgtggccccgatggctccgtgctgccgttgaaggccgatccggtcgcc
ttccgcgcccagcatccgccgcagacggcctcggtgctccagggtctcaacgagccgcag
tggaacgatgcggcctggatggacacgcgcggtgagaaggatccgcgccacgccgccatg
tcggtctacgaggtccatctcggctcgtgggcgcgggtgccggacgagggcaaccgctac
ctgacctacaaggagctgtccgaccggctgatcccgtacgtgaaggacctcggcttcacg
catatcgagcttctgccgatcaccgagtacccgttcgacggatcctggggctaccagccg
gtctcgctgttcgcgccgaccagccgcttcggcacgcccgacgacttcgtcgatttcgtc
aatgcggcgcatgcggccggcatcggcgtgatgctcgattgggtgccggggcacttcccc
ctcgacgctcacggcctcggcctgttcgacggcacgcatctctacgagcatgccgatccg
cgccagggcttccaccaggattggggcacctacatctacaatttcggccgggtcgaggtg
tccgccttcctcacggccaatgcccgcttctggctcgaacactaccatctcgacggcctg
cgcgtggatgcggtggcctcgatgctctacctcgactactcgcgccgcgcgggggagtgg
attccgaaccagtacggcggcaacgagaatctcgacgccatcaacttcctgcgcaaaacc
aacgaggccacctacagccacgcgccgggcaccatcacggtggccgaggaatcgacctcg
tggccgggcgtgtcgcacccgacctacacgggcggtctcggcttcggcttcaagtggaac
atggggtggatgcacgacaccctgaaatacatgtcggaggacccgatccaccggcgttac
caccaccacaacctgaccttcggcctgctctacgccttctcggaaaacttcgttctgccg
ctctcccacgacgaggtggtgcacgggaagggctcgctgctcggcaagatgccgggcgac
cgttggcagaagtttgccaatctgcgcgcctatttcggcttcatgtgggggcaccctggc
aagaagctgctcttcatgggcggcgagttcggccaggagcgcgagtggaaccacaaccag
tcgctcgactggcacctgctcgacgatcccctgcatggcggcgtgaaggatctgatccgc
gacctcaaccacgtctacacctcgaccccggcgctctattcgcgcgacgtcgaggccagc
ggcttccagtggctggtggcggacgattccgacaactcggtcatcgcctgggcgcgcaag
ggcaaggcagagggcgaggtcgccatcgtcgtctcgaacttcacgccggtgccacgtgag
ggctaccgcgtcggcgtgccgacggccggtttctaccgcgaggcgatcaactcggatgcc
gagcgctatggcggctcgaatgtcggcaatatgggcggtgtgcagagccaggctgaacag
agccacggccagccgcactcgctgagcctgacgctgccgccgctttcgaccctgatcctg
attcgcgagggctga

DBGET integrated database retrieval system