KEGG   Methylobacterium extorquens PA1: Mext_2789Help
Entry
Mext_2789         CDS       T00640                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00010  Glycolysis / Gluconeogenesis
mex00020  Citrate cycle (TCA cycle)
mex00620  Pyruvate metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
Module
mex_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_2789
   00020 Citrate cycle (TCA cycle)
    Mext_2789
   00620 Pyruvate metabolism
    Mext_2789
Enzymes [BR:mex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mext_2789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABY31180
JGI: Mext2789
UniProt: A9W6H4
Position
3127477..3128889
Genome map
AA seq 470 aa AA seqDB search
MPINVLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKIL
VAEGTADVPVNELIALIAEEGEDPGSVQAPKGGAEAKTAPVEPKGTPDQNAAPDGSHASY
ARVDQVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQ
AAIENGTAKADAAAKPEAKSEAKSAPAPEKTAPKAASGGGAPAGLSLDQVKGFYEKGSFE
EVPLDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNNSAGKDKDGKPLFKLS
VNDFVIKAMGLALTRVPAANAVWAEDRILRFTHAEVGVAVAIDGGLFTPVIRKADQKTLS
TISNEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEK
RVVVKDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtcctgatgcccgcgctctccccgaccatggagaagggcaacctcgcc
aagtggctcaagaaggagggcgacgccatcaagtccggcgacgtcatcgccgagatcgag
accgacaaggccaccatggaggtcgaggcggtcgatgagggcgtgctcgccaagattctc
gtggccgaaggcaccgccgacgttccggtcaacgagctgatcgcgctgatcgctgaagag
ggtgaggatccgggcagcgtccaggcgcctaagggtggtgccgaggcgaagaccgccccc
gtcgagccgaagggcacgcccgaccagaacgccgcgcccgatggctcccacgcctcctac
gcgcgcgtcgatcaggtgcccgaaggtgccaagccgaacggcgctgcgcagccggctggc
tccggcgatcgcgtcttcgcctcgccgctcgcgcgccgcatcgcgaagcaggaaggcgtc
gatctctcggcagtgaagggctcgggtccgcatggccgcgtgatccagcgcgacgtgcag
gcggcgatcgagaacggcacggcgaaggccgatgcggcggccaagcccgaggccaaatcg
gaggccaagagtgctcctgctcccgagaaaaccgcgccgaaggcggcttccggcggcggc
gccccggccgggctcagcctcgatcaggtcaagggcttctacgagaagggcagcttcgag
gaagtgccgctcgacggcatgcgcaagaccatcgccaagcgcctcaccgaggccatgcag
gtcgcgccgcacttctacctcaccgtcgattgcgaactcgatgcgctgatgaagctgcgc
gagacgctcaacaactcggccggcaaggacaaggacggcaagccgctgttcaagctctcg
gtgaacgacttcgtcatcaaggcgatgggcctcgcgctcacccgcgtccccgccgccaac
gccgtctgggcggaggaccgcatcctgcgcttcacgcacgccgaggtcggcgtcgcggtg
gcgatcgatggcggcctattcaccccggtgatccgcaaggccgaccagaagacgctctcc
accatctccaacgagatgaaggatttcgccggccgggcgcgtgccaagaagctgaagccc
gaggagtaccagggcggcgtcacctcagtgtcgaacctcggcatgttcggcatcaagcac
ttcacggcggtgatcaacccgccgcaatcgagcatcctcgcggtcggcgcgggcgagaag
cgcgtggtggtgaaggacgggcagccgaccgttgcccaggtgatgacggcgaccctctcc
tgcgatcaccgcgtcctcgacggcgcgctcggcgccgagttgatcgcggccttcaaggga
ctgatcgagaacccgatggggatgctcgtctaa

DBGET integrated database retrieval system