KEGG   Methylobacterium extorquens PA1: Mext_2789Help
Entry
Mext_2789         CDS       T00640                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mext_2789
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_2789
   00020 Citrate cycle (TCA cycle)
    Mext_2789
   00620 Pyruvate metabolism
    Mext_2789
Enzymes [BR:mex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mext_2789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3127477..3128889
Genome map
AA seq 470 aa AA seqDB search
MPINVLMPALSPTMEKGNLAKWLKKEGDAIKSGDVIAEIETDKATMEVEAVDEGVLAKIL
VAEGTADVPVNELIALIAEEGEDPGSVQAPKGGAEAKTAPVEPKGTPDQNAAPDGSHASY
ARVDQVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQ
AAIENGTAKADAAAKPEAKSEAKSAPAPEKTAPKAASGGGAPAGLSLDQVKGFYEKGSFE
EVPLDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNNSAGKDKDGKPLFKLS
VNDFVIKAMGLALTRVPAANAVWAEDRILRFTHAEVGVAVAIDGGLFTPVIRKADQKTLS
TISNEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEK
RVVVKDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtcctgatgcccgcgctctccccgaccatggagaagggcaacctcgcc
aagtggctcaagaaggagggcgacgccatcaagtccggcgacgtcatcgccgagatcgag
accgacaaggccaccatggaggtcgaggcggtcgatgagggcgtgctcgccaagattctc
gtggccgaaggcaccgccgacgttccggtcaacgagctgatcgcgctgatcgctgaagag
ggtgaggatccgggcagcgtccaggcgcctaagggtggtgccgaggcgaagaccgccccc
gtcgagccgaagggcacgcccgaccagaacgccgcgcccgatggctcccacgcctcctac
gcgcgcgtcgatcaggtgcccgaaggtgccaagccgaacggcgctgcgcagccggctggc
tccggcgatcgcgtcttcgcctcgccgctcgcgcgccgcatcgcgaagcaggaaggcgtc
gatctctcggcagtgaagggctcgggtccgcatggccgcgtgatccagcgcgacgtgcag
gcggcgatcgagaacggcacggcgaaggccgatgcggcggccaagcccgaggccaaatcg
gaggccaagagtgctcctgctcccgagaaaaccgcgccgaaggcggcttccggcggcggc
gccccggccgggctcagcctcgatcaggtcaagggcttctacgagaagggcagcttcgag
gaagtgccgctcgacggcatgcgcaagaccatcgccaagcgcctcaccgaggccatgcag
gtcgcgccgcacttctacctcaccgtcgattgcgaactcgatgcgctgatgaagctgcgc
gagacgctcaacaactcggccggcaaggacaaggacggcaagccgctgttcaagctctcg
gtgaacgacttcgtcatcaaggcgatgggcctcgcgctcacccgcgtccccgccgccaac
gccgtctgggcggaggaccgcatcctgcgcttcacgcacgccgaggtcggcgtcgcggtg
gcgatcgatggcggcctattcaccccggtgatccgcaaggccgaccagaagacgctctcc
accatctccaacgagatgaaggatttcgccggccgggcgcgtgccaagaagctgaagccc
gaggagtaccagggcggcgtcacctcagtgtcgaacctcggcatgttcggcatcaagcac
ttcacggcggtgatcaacccgccgcaatcgagcatcctcgcggtcggcgcgggcgagaag
cgcgtggtggtgaaggacgggcagccgaccgttgcccaggtgatgacggcgaccctctcc
tgcgatcaccgcgtcctcgacggcgcgctcggcgccgagttgatcgcggccttcaaggga
ctgatcgagaacccgatggggatgctcgtctaa

DBGET integrated database retrieval system