KEGG   Methylobacterium extorquens PA1: Mext_2873Help
Entry
Mext_2873         CDS       T00640                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00010  Glycolysis / Gluconeogenesis
mex00052  Galactose metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_2873
   00052 Galactose metabolism
    Mext_2873
Enzymes [BR:mex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Mext_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABY31263
JGI: Mext2873
UniProt: A9W6Q7
Position
complement(3219123..3220163)
Genome map
AA seq 346 aa AA seqDB search
MRSEPFGTTRAGERVTRYTLVRDDLRVQVIDYGAVVTAIEVPDREGRRANVVLALDTVEG
YETVSPHFGAIAGRYANRIAKGRFTLDGTPFELPINEPPDSMHGGPEGFAKRLWPVAEAD
DTRVVLRRRSPDGEQGFPGNLDIEVVYSLPEPGTLRIDYRAETDRPTVLNLTNHSYFNLA
GEGTGDVMDHVVQIVADTYAPTDATQIPTGIIAPVAGTPLDFREPTPLGAGIRQGDEQIV
IAGGYDHTFALREPAGTLRPAASCYCPASGRRLDVATTQPALQLYSGNNLDGSLVGPSGR
TYRSGDGVCFETQGFPDAPNHPNFPSAVLRPGEVFTSISTYRFSVG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcagagccattcggaacgacgcgggcgggtgagcgcgtcacgcggtacaccctc
gtgcgcgacgatctgcgggttcaggtgatcgattacggcgcggtcgtcaccgccatcgag
gtgccggatcgggagggccgccgcgccaacgtcgtcctcgccctcgatacggtggagggt
tacgagacggtgagcccgcatttcggggcgattgccgggcgctacgccaaccgcatcgcc
aaggggcgcttcaccctcgacgggacccccttcgaactgccgatcaacgagccgcccgat
tccatgcatggcggccccgagggtttcgccaagcgcctatggcccgtggcggaggcggac
gacacgagggtcgtgctgaggcggcgcagccccgacggcgagcagggctttccgggcaat
cttgacatcgaggtcgtctacagcttgcccgagcctggaacgctgcgcatcgattaccgc
gccgagaccgaccggccgaccgtgctgaacctgaccaatcacagctacttcaacctcgcc
ggcgagggcacgggcgacgtgatggaccacgtcgtgcagatcgtcgccgacacctacgcg
ccgacagacgcaacgcagatcccgaccggaatcatcgcgccggttgccggcacgcccctc
gatttccgtgagcccacgccgctcggtgcaggcattcggcagggcgacgagcagatcgtg
atcgcgggcggctacgaccataccttcgctctgcgagaacccgccggcacgctgcgcccg
gcagcctcctgctactgcccggccagcggacggcgcctcgacgtcgcgacgacccagccg
gcgctgcaactctacagcggcaacaatctcgacggctcgctggtcggcccgtccggccgc
acctaccgctcgggcgacggcgtctgcttcgagacgcaggggtttcccgatgcgccgaac
cacccgaactttccgagcgcggtcctgaggccgggcgaggtttttacctcgatcagcacc
taccgattctcggtcggctga

DBGET integrated database retrieval system