KEGG   Methylobacterium extorquens PA1: Mext_2964Help
Entry
Mext_2964         CDS       T00640                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mext_2964
Enzymes [BR:mex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mext_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3311400..3312710)
Genome map
AA seq 436 aa AA seqDB search
MRLPQEIIRDKRDGHALSEADIAGFIEGLTRDQVTEGQAAAFAMAVFFRGLSLDERVALT
RAMTHSGTVLAWDLPGPVLDKHSTGGVGDTVSLPLAAMVAACGGYVPMISGRGLGHTGGT
LDKLASIRGYDVTPGLDRFRKVTAEAGCAIIGQTAELAPADRRLYAIRDVTGTVESLDLI
TASILSKKLAAGLQGLVMDVKTGSGAFMARREDARALAESIVTVANAAGLRTRALITDMD
APLASCAGNAVEVAYAVDYLTGRAREPRFHAVTMALAVEMLVIGGLAANIAEAEGKLTAA
LDSGRACEAFARMVAALGGPGDFVEAAYRHLPPAPVVRPVPAQEAGVVEAVETRAIGLAV
IGLGGGRTRPQDAIDARVGFTGLARPGDRLSPNDPIGIVHAADEAAAERAAASLRAAYRI
GATPPEPRAAVLERLG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcccccaggagatcatccgcgacaagcgcgacggacacgccctgtccgaggcc
gacatcgccggcttcatcgaggggctgacgcgggatcaggttaccgaggggcaggccgcg
gcgtttgccatggcggtgttcttccgcggcctctcgctcgacgagcgcgtggcgctgacc
cgcgccatgacgcattcgggcacggtgctcgcgtgggatctgcccggccccgtcctcgac
aagcactccaccggcggcgtcggcgacaccgtgagccttccgctcgccgcgatggtcgcg
gcctgcggcggctacgtgccgatgatctccgggcgcggcctggggcataccggcggcacg
ctggacaagctcgcgagcattcgcggctacgacgtgacgccgggcctcgaccggttccgc
aaggtcacggccgaggccggttgcgccatcatcggccagaccgccgagctcgcgccggcc
gaccggcgcctctacgcgatccgcgacgtcaccgggacggtggaatcgctcgatctcatc
accgcgtcgatcctgtcgaagaagctcgcggcggggctccagggcctcgtcatggatgtg
aagaccggctccggcgccttcatggcccgtcgcgaggatgcgcgggcgcttgccgagagc
atcgtaacggtcgccaacgcggcgggactgcgcacgcgcgcgctcatcaccgacatggac
gccccgctggcctcctgcgccggcaacgcggtcgaggtggcctatgccgtcgattacctc
accggtcgcgcccgcgaaccgcgcttccacgccgtgacgatggcgctggccgtcgagatg
ctggtgatcggggggctggctgcaaacatcgcggaggcggaagggaagctgacggcggcg
ctcgattcgggccgggcctgcgaggccttcgcgcggatggtggcggcgctgggcggcccc
ggcgatttcgtcgaggcggcataccggcacctgcccccggcgccggtcgtgcggccggtg
ccggcgcaggaagcgggcgtggtggaggcggtggagacccgcgccatcggcctcgcggtg
attggcctcggcggagggcgcacccggccgcaggatgccatcgacgcccgcgtcggtttc
accggcctcgcgcggccgggcgaccgactgtcaccgaacgatccgatcggcatcgtccac
gccgcggacgaggccgccgccgagcgggcagcggcatcgctgcgggcggcctatcggatc
ggcgcaacgccgccggagccacgcgcggccgtactggagcgcttgggctga

DBGET integrated database retrieval system