KEGG   Methylobacterium extorquens PA1: Mext_3254Help
Entry
Mext_3254         CDS       T00640                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mext_3254
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mext_3254
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mext_3254
Enzymes [BR:mex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mext_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3610587..3611999)
Genome map
AA seq 470 aa AA seqDB search
MLHVSTRGAAAPLSFSDALLAGLARDGGLYVPESWPQISHAEIAGFAGMRYAEVAKRVLR
PLIDGEIPDDALDEMIEAAYATFRHPAICPLTQIDDNLFLMELFHGPTLAFKDVAMQLLG
RLMDYVLRQKGGRATIVGATSGDTGSAAVEAFKGLDQVDVFILFPHGRVSEVQRRQMTTV
NAPNVHALAIDGNFDDCQNIVKAMFQHGDFADRVKLSGVNSINWARVAAQTVYYFTSAVA
LGAPHRKVSFAVPTGNFGDILAGWVAKRMGLPIERLMIGTNANDILARTLEHGAYEPRGV
QPTTSPSMDIQISSNFERLLFEALGRDASALGRLMAGLKQSGGFSLSPEVLGTVRNEFDA
TAVREPDVVEEIAGTYRKTGLVLDPHSAIGVRAGRRLLEKDPATPVVALATAHPAKFPDA
VSQATGGGRPVLPPHLAELMTRPETVANLANDQAAIERYITEHARITRAN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcacgtctcgacccgcggcgccgctgcgcccttgagcttttccgatgcgctgctc
gccggcctcgcccgcgacggcggtctctacgtgcccgagagctggccgcagattagccat
gcggagatcgcgggcttcgccggcatgcgctacgccgaggtcgccaagcgcgtgctgcgt
ccgctcatcgacggcgagattccggacgacgcgctcgacgagatgatcgaggcggcctac
gccaccttccgccatccggcgatctgcccgctcacccagatcgacgacaacctgttcctg
atggagctgtttcacgggccgacgctcgcgttcaaggacgtggcgatgcagctcctcggg
cggctgatggattacgtgctgcgccagaagggcggccgcgccaccatcgtcggcgccacc
tcgggcgatacgggcagtgccgcggtcgaggccttcaaggggctcgatcaggtcgacgtg
ttcatcctgtttccgcacggccgcgtctcggaggtgcagcgccggcagatgaccacggtc
aacgcgccgaacgtccacgcgctcgccatcgacggcaatttcgacgattgccagaacatc
gtgaaggcgatgttccagcacggcgacttcgccgacagggtgaagctctcgggcgtcaac
tcgatcaattgggcgcgcgtcgccgcgcagaccgtctactacttcacgagcgccgtggcc
ttgggcgccccgcaccggaaggtgtcgttcgcggtgccgaccggcaatttcggcgacatt
ctcgccggctgggtcgccaagcggatgggcctgccgatcgagcggctgatgatcggcacc
aacgccaacgacatcctggcccgcaccctggagcacggggcctacgagccccgcggcgtg
cagccgacgacctcgccctcgatggatatccagatctcctcgaacttcgagcggctgctg
ttcgaggcgttgggccgcgacgcctccgcgctcggccgcctgatggcgggtctgaagcag
tcgggcgggttctcgctgagccccgaggtgctgggcaccgtgcgcaacgagttcgatgcg
accgccgtgcgcgagcccgacgtcgtggaagagatcgcgggcacctaccgcaagaccggc
ctcgtgctcgatccgcacagcgccatcggcgtgcgcgccggccgccggctgctggagaag
gatccggccaccccggtcgtggcgctggcaaccgcgcaccccgctaaattcccggatgcg
gtctcgcaagcgaccggcggcgggcgcccggttctgccgccccacctcgccgaactgatg
acccggcccgagacggtggcgaacctcgccaacgatcaggccgcgatcgagcgctacatc
acggaacacgcccgcatcacccgggccaactga

DBGET integrated database retrieval system