KEGG   Methylobacterium extorquens PA1: Mext_3274Help
Entry
Mext_3274         CDS       T00640                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00040  Pentose and glucuronate interconversions
mex00052  Galactose metabolism
mex00500  Starch and sucrose metabolism
mex00520  Amino sugar and nucleotide sugar metabolism
mex01100  Metabolic pathways
mex01130  Biosynthesis of antibiotics
Module
mex_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mext_3274
   00052 Galactose metabolism
    Mext_3274
   00500 Starch and sucrose metabolism
    Mext_3274
   00520 Amino sugar and nucleotide sugar metabolism
    Mext_3274
Enzymes [BR:mex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mext_3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ABY31661
JGI: Mext3274
UniProt: A9W6Z9
Position
3635736..3636602
Genome map
AA seq 288 aa AA seqDB search
MKRIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGRG
KAVIEDHFDIAFELDHMLQERGKQAAYEELKKDLPKAGQTSFTRQQAPLGLGHAVWCARE
IVGDEPFAVLLPDMLSRGCMGQMLKAYEQHGGNVIAVEEVKPEETHQYGIVAVGETFGQT
FEITGMVEKPKQGTAPSNYIISGRYILQPEIFSILERGETGAGGEIQLTDAMIRLAEEQK
FYGMRFDGRTYDTGSKIGFLTANLAYGLERPELADALKAEIRALLGEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcgcaaggccgtccttcccgtcgcgggtctcggcacgcgcttcctgccg
gccaccaaggccgttccgaaggagatgctcaccgtcgtcgaccggccggtcgttcaacac
gtcgtcgatgaagcccgcgaggccggcatcgaacacttcatcttcgtgaccggccgcggc
aaggcggtgatcgaggatcatttcgatatcgcgttcgaattggaccacatgctgcaggag
cgcggcaagcaggcggcctacgaggagctgaagaaggacctgcccaaggccggccagacc
agcttcacccggcagcaggcgccgctgggcctcggccacgccgtctggtgcgcccgcgag
atcgtcggcgacgaacccttcgccgtgctgctgcccgacatgctgagccggggctgcatg
ggccagatgctgaaggcctacgagcagcatggcggcaacgtcatcgccgtggaagaggta
aagcccgaagagacccaccagtacggcatcgtcgccgtcggcgagaccttcggccagacc
ttcgagatcaccggcatggtcgagaagcccaagcagggcaccgcgccctcgaactacatc
atctccggccgctacatcctccagcccgagatcttctcgatcctggagcggggcgagacc
ggcgcgggcggcgagatccagctcaccgacgcgatgatccggctggccgaagagcagaaa
ttctacggtatgcgcttcgatgggcgcacctacgacaccgggtccaagatcggcttcctc
acggccaacctcgcctacggcctggagcggccggaactggccgatgccctgaaagcggag
atccgcgcgcttctcggcgaggcctga

DBGET integrated database retrieval system