KEGG   Methylobacterium extorquens PA1: Mext_3274Help
Entry
Mext_3274         CDS       T00640                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mext_3274
   00052 Galactose metabolism
    Mext_3274
   00500 Starch and sucrose metabolism
    Mext_3274
   00520 Amino sugar and nucleotide sugar metabolism
    Mext_3274
Enzymes [BR:mex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mext_3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3635736..3636602
Genome map
AA seq 288 aa AA seqDB search
MKRIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGRG
KAVIEDHFDIAFELDHMLQERGKQAAYEELKKDLPKAGQTSFTRQQAPLGLGHAVWCARE
IVGDEPFAVLLPDMLSRGCMGQMLKAYEQHGGNVIAVEEVKPEETHQYGIVAVGETFGQT
FEITGMVEKPKQGTAPSNYIISGRYILQPEIFSILERGETGAGGEIQLTDAMIRLAEEQK
FYGMRFDGRTYDTGSKIGFLTANLAYGLERPELADALKAEIRALLGEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcgcaaggccgtccttcccgtcgcgggtctcggcacgcgcttcctgccg
gccaccaaggccgttccgaaggagatgctcaccgtcgtcgaccggccggtcgttcaacac
gtcgtcgatgaagcccgcgaggccggcatcgaacacttcatcttcgtgaccggccgcggc
aaggcggtgatcgaggatcatttcgatatcgcgttcgaattggaccacatgctgcaggag
cgcggcaagcaggcggcctacgaggagctgaagaaggacctgcccaaggccggccagacc
agcttcacccggcagcaggcgccgctgggcctcggccacgccgtctggtgcgcccgcgag
atcgtcggcgacgaacccttcgccgtgctgctgcccgacatgctgagccggggctgcatg
ggccagatgctgaaggcctacgagcagcatggcggcaacgtcatcgccgtggaagaggta
aagcccgaagagacccaccagtacggcatcgtcgccgtcggcgagaccttcggccagacc
ttcgagatcaccggcatggtcgagaagcccaagcagggcaccgcgccctcgaactacatc
atctccggccgctacatcctccagcccgagatcttctcgatcctggagcggggcgagacc
ggcgcgggcggcgagatccagctcaccgacgcgatgatccggctggccgaagagcagaaa
ttctacggtatgcgcttcgatgggcgcacctacgacaccgggtccaagatcggcttcctc
acggccaacctcgcctacggcctggagcggccggaactggccgatgccctgaaagcggag
atccgcgcgcttctcggcgaggcctga

DBGET integrated database retrieval system