KEGG   Methylobacterium extorquens PA1: Mext_3312Help
Entry
Mext_3312         CDS       T00640                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mex00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mex00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3673580..3674527
Genome map
AA seq 315 aa AA seqDB search
MTAQTAPAFPHRHLLGIEGLSRPDIEALLERADAAVALSRQVEKKRTVLRGRTQINLFFE
PSTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAATLNAMRPDIIVVRHHAAGA
VHLLARKVDCAVVNAGDGAHEHPTQALLDALTIRRNKGGIEGLQVAICGDVLHSRVARSN
IILLQALGARVRVIGPSTLLPTGIERFGVEVFTDMRAGLKGCDIVMMLRLQRERMNGSFV
PSVKEYFRYYGLDGDKLALAKPGALVMHPGPMNRGVEIASDIADGTQSLIREQVEMGVAV
RMAVLEALATHLPNG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagaccgcacccgccttcccgcaccggcacctgctcggcatcgaaggcctg
agccggccggacatcgaagcgctcttggagcgcgccgacgccgccgtcgccctgtcgcgg
caggtcgagaagaagcgcaccgtcctgcggggccgcacgcagatcaacctgttcttcgag
ccctcgacccgcacgcaatcctcgttcgaactcgcgggcaagcgcctcggcgccgacgtg
atgaacatgtcggtcgcctcgtcctcggtgaagaagggcgagacgctgatcgacacggcc
gcgacgctcaacgccatgcggcccgacatcatcgtggtgcgccaccacgcggcgggcgcg
gtgcatctgctcgcccgcaaggtcgattgcgccgtggtcaacgccggcgacggcgcccac
gagcacccgacccaggcgctgctcgacgcgctcaccatccgccgcaacaagggcggcatc
gaggggcttcaggtcgcgatctgcggcgacgtcctgcattcgcgggtggcgcgctcgaac
atcatcctgcttcaggcgctgggcgcccgggtgcgggtgatcggcccctcgacgctgctg
cccaccggcatcgagcgcttcggggtcgaggtgttcaccgatatgcgcgcgggtctgaaa
ggctgcgacatcgtgatgatgctgcgcctccagcgcgagcggatgaacggctccttcgtg
ccgagcgtgaaggagtatttccgctattacggcctcgacggcgacaagctggcgctggcc
aagcccggcgcgctggtgatgcatccgggtccgatgaaccgcggcgtcgagatcgcctcc
gacatcgccgacgggacgcagtcgctgatccgcgagcaggtcgagatgggcgtcgccgtg
cgcatggccgtgctggaagcgctggcgactcacttgccgaacgggtga

DBGET integrated database retrieval system