KEGG   Methylobacterium extorquens PA1: Mext_3554Help
Entry
Mext_3554         CDS       T00640                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mex00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3931329..3933251
Genome map
AA seq 640 aa AA seqDB search
MCGLCGYIDPWHKDSRDVLVRMADLLRHRGPDDAGVEQGEGWGLGFRRLAILDLSPNGHQ
PMSYGDGRFHLAFNGEIYNHVELRRDLEAEGERFRGGSDTEVLLRLLAKRGEAALPLLNG
MFAFAFIDAERRTFLLARDRLGVKPLYYATRGGSLRFASEPKALLAWPGERREIDDEAVT
RYLALGYLPGETAIFRGHAKLPPAHVMVGSLEAPCAARTRPYWDLSLSDNPDRRSLIPRE
TEELEHLLRDAVRIRLRSDVPVGVFLSGGVDSGLVAACAADAPGPRPLALTVGFAEGDTD
ETDLARATAGHVGLDHRVVTQPVEGLDRLDDLAWFFDEPFGDPSALPTFTLCEAAATVGR
VFLSGDGGDEAFAGYRRYVEALRHRHLIGAARFVAPALRVAAGLAPALSPLQARLAKLGL
PDRGCAAAFDELPADPALAAVVHPRLRPLLAEAGAPLWERWARSRGRSTTLRQQDLDYRL
YLPDDVLVKVDRASMAHSVEVRSPLLDVRLVEWAARLPRAALLDAHEGKLPLRALGRRLL
PEAVERGAKRGFGVPLDAWFREPRGRALVWERLLDGHGADLGHWDRRGVGRILDVHGSGT
GRGFGVLLWRLLMLEAWTRQHTAPMRPVEPRPASAPANAA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcctgtgcggctacatcgacccctggcacaaggatagccgggacgttctcgtt
cgcatggcggatctcctccgccatcgcggacccgacgacgcgggagtcgagcaaggggag
ggttggggcttggggttccgccgcctcgccatcctcgacctcagtcccaacggccaccag
cctatgagctacggggacgggcgcttccatctcgccttcaacggcgaaatctacaaccac
gtcgagctgcgccgggacctggaggcggagggtgaacgcttccgaggcggctccgatacg
gaggttctgctgcggctcctcgcaaagcggggagaggccgcgctgccactgctcaacggc
atgttcgccttcgccttcatcgacgctgagcgccgcacctttctgctggcccgcgaccgc
cttggggtgaagccgctctactacgcgaccagggggggaagcctgcggttcgcctccgag
cccaaagccctgctggcttggccgggcgagcggcgcgagatcgacgacgaggccgtgacc
cgctacctcgcgctaggatacctgcccggcgaaacggctatattccgcggccacgccaag
ctcccgccggcccacgtcatggtgggctccctggaggccccctgtgccgcacggacgcgt
ccctactgggatctgtcgctgagcgacaatccggaccggcggtcgctaatcccccgcgag
acggaggagctggagcacctcttgcgggacgccgtccgcatccggctgcgcagcgacgtg
ccggtgggggtgttcctgtcaggcggcgtggacagcggtctcgtcgccgcctgcgccgcc
gatgcaccggggccgcgtccgctcgccctgacggtaggattcgcggagggcgacaccgat
gagaccgatctcgctcgcgccacggcggggcatgtcgggttggatcaccgcgtcgtcact
cagccggtggagggcctcgaccgcctggacgacctcgcgtggttcttcgacgagccgttc
ggcgacccgtccgcgctgcccaccttcaccctctgcgaggccgctgcgacggtgggtcgg
gtgttcctgtcgggcgacgggggcgacgaggccttcgccggctaccggcgctacgtggag
gcgcttcgccaccgacacctcatcggcgcggcgcggttcgtggcgccggcccttcgcgta
gccgccgggctggctcccgccctctcgcccctgcaggctcggctggcaaagctcggcctg
cccgaccggggctgcgccgccgcgttcgacgaactgcccgcagaccccgccctggccgct
gtcgtgcacccgcgcctgcgcccactcctcgcggaggcgggagcacccctgtgggagcga
tgggcccgcagccgcggccgatcgacgaccctgcgccagcaggatctagattaccgcctc
tacttgcccgacgacgtgctcgtgaaagtcgaccgcgcctcgatggcccattccgtcgag
gttcggtccccgctgctcgacgtgcgcctggtggagtgggctgcccgcctgccgcgcgcg
gcactcctcgacgcacatgagggcaagctcccgctgcgcgctctcggccggcggctcctt
ccggaagccgttgagcgcggcgccaagcggggcttcggcgtacccctcgacgcatggttc
cgcgagccccggggacgggcgctcgtgtgggagcggctgctggacggacacggggcggac
ctgggccactgggaccgccgaggcgtgggtcgcatcctagacgtccacggttcaggcacc
gggcgaggcttcggggtcctcctgtggcgtctcctcatgctggaagcctggaccaggcag
cacacagcgccgatgcggcccgtggagccccggcctgcgagcgctccggcgaacgcggcc
tag

DBGET integrated database retrieval system