KEGG   Methylobacterium extorquens PA1: Mext_3930Help
Entry
Mext_3930         CDS       T00640                                 

Definition
dihydrofolate reductase
Orthology
K17364  
dihydromethanopterin reductase [EC:1.5.1.47]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mex00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4369568..4369975)
Genome map
AA seq 135 aa AA seqDB search
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPE
FAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEAD
RWFDPAWLVGGPLRS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgtccgctgcatctgtgccatcggccagcggggccagctcggcctcaacggg
caccttccctgggagggcaacaccgatccgctcttcgtcgaggacgtgacgcgcttcttc
gcgctcaccatgggccacgtgctgatcgccggccccaagaccgtggcctccgtgcccgaa
ttcgcgttcaaggaccgcaccatcgacgtgatccgctcgcacgaggatcccgaggcggtg
ctgaagcgctatcccggccggcgcatcttcgtcggcggcggcatcgcggtctggaacgtc
tacgcgaaatacatccagcactgggacgtcacccgcctcccctacgacggcgaggccgac
cggtggttcgacccggcctggctcgtcggcgggccgctgcggagctga

DBGET integrated database retrieval system