KEGG   Methylobacterium extorquens PA1: Mext_3983Help
Entry
Mext_3983         CDS       T00640                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mex  Methylobacterium extorquens PA1
Brite
Enzymes [BR:mex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mext_3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4426158..4427267)
Genome map
AA seq 369 aa AA seqDB search
MWAACPVRRSLRHRMSPDPDRDRSFVLAQRSFELMRDYCACATPRAYAVWYLYVSGTQPL
MNDAVKRLTTQNGTLTSADIEGLHDTYIDGRRMAVEVDRMNSSLIAEVEGIMEMIEVSIR
STAQYGESLQALSHDIANTATSRTRLREVVTTIIANTRDVTANNRTLEARMRESRSEIEA
LRETLEATRLESLTDALTGLGNRKNFEESLRKSVDRQSASAQQGKPASLIVIDIDSFKRF
NDLYGHLTGDQVLRLVAIVMREHIGEKNATLARFGGEEFGIVLPETDRVEARAIAERVRI
GVTGRELVKRSTGESLGKVTVSLGVATQREDDNAVSLLERADACLFAAKRAGRNRTLDET
EVENLRDVA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcggcgtgccccgtccgcaggagcctacgtcaccggatgagccccgatcccgat
cgtgatcgcagtttcgtgctcgcgcagcgcagcttcgagctgatgcgcgactactgtgcc
tgcgcgacgccgcgggcctacgccgtgtggtatctctacgtctccggcacgcagccgctg
atgaacgatgcggtcaaacggctcacgacgcagaacggcacgctgaccagcgccgacatc
gaggggctccacgacacctacatcgacggccgccgcatggccgtggaggtggaccggatg
aattcgagcctcatcgccgaggtcgagggcattatggagatgatcgaggtctcgatccgc
tccaccgcccagtacggcgagtcgcttcaggccctgtcccacgacatcgccaacacggcc
acgagccggacgcgtctgcgcgaggtcgtcacaacgatcatcgccaacacccgcgacgtg
accgccaacaaccgcaccctcgaagcgcggatgcgcgagagccgcagcgagatcgaagcc
ttgcgcgagacgctggaggcgacccgtctggagagcctgaccgacgccctgacggggctg
ggcaaccgcaagaatttcgaggagtcgctccgcaagagcgtcgatcggcagtctgcctca
gcgcagcagggcaagccggcgagcctgatcgtgatcgacatcgattcgttcaagcgcttc
aacgacctctacggccacctgaccggggatcaggtgctgcgcctcgtcgccatcgtgatg
cgcgagcatatcggtgagaaaaacgcgacgctcgcccggttcggcggcgaggaattcggc
atcgtcctgccggaaacggaccgggtcgaggcgcgcgccatcgccgagcgggtgcgcatc
ggcgtcaccggccgcgaactggtgaagcgctccaccggggaatcgctcggcaaggtcacg
gtctcgctcggcgtcgcgacccagcgcgaggatgacaacgcggtctccctgctggaacgg
gccgatgcctgcctgttcgccgccaagcgcgccggccgcaaccgcaccctcgacgagacc
gaggtcgagaacctgcgcgacgtcgcctga

DBGET integrated database retrieval system