KEGG   Methylobacterium extorquens PA1: Mext_4066Help
Entry
Mext_4066         CDS       T00640                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mext_4066
Enzymes [BR:mex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mext_4066
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mext_4066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4521667..4523172
Genome map
AA seq 501 aa AA seqDB search
MPDAVGAIDQGTTSTRFIVFDRRGTILAQAQREHEQIFPRPGWVEHDPREIWRNTHAVMR
EGLARAGLAPEDLAAIGITNQRETAVLWDRRTGEPLHDAIVWQDTRTDRSVAALARDGGR
DRFRAVTGLPLASYFSASKLAWLLDHVEGARAKAEDGTALFGTIDSWLVWNLTGGPDGGL
HVTDVTNASRTQLMSLATLDWDEAMLGVFRIPRAVLPTIVSSSAVLGEARDPFPGVPLGG
ILGDQQAALFGQTCFSAGEAKNTYGTGCFALMNTGPAPVASSAGLITTVAYRLDGRPPAY
ALEGSIAITGALVQWLRDNLGLIGASSEIEGLARSVEDNGGVYVVPAFSGLYAPHWRDDA
RGLIIGLTRYANRGHIARACLEATAYQTREVLEAMERDSGCPIAELRCDGGMTVNDLLMQ
FQADILDRPTLRPKVSETTALGAAYAAGLATGFWKTLEDLRDNWAVDKRWHPHIQAEERR
ALFAGWSRAVERSFGWVEENA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgcggtcggggcgatcgaccagggcaccacgagcacgcgcttcatcgtgttc
gaccgccggggcacgatcctggcgcaggcccagcgcgagcacgagcagatcttcccccgt
cccggctgggtcgagcacgacccgcgggagatctggcgcaacacccatgcggtgatgcgc
gaggggctggcccgcgccgggctggcgccggaggatctggccgccatcggcatcaccaac
cagcgcgagaccgccgtgctctgggaccggcggaccggcgagccgctgcacgatgccatc
gtctggcaggacacccgcaccgaccggtccgtcgccgcgctcgcccgcgacggggggcgc
gaccgcttccgcgccgtgaccggcctgccgctcgcgagctacttctccgcctccaagctc
gcttggctgctcgaccacgtggagggcgcgcgggcgaaggccgaggacggcaccgccctg
ttcgggacgatcgattcctggctcgtctggaatctcaccggtggcccggatggcgggctc
cacgtcaccgacgtgaccaatgccagccgcacgcagctcatgtcgctcgcgaccctcgat
tgggacgaggcgatgctcggcgtgttccgcatcccgcgggcggtgctgccgacgatcgtc
tcctccagcgccgtgctgggcgaggcccgtgacccgtttcccggcgtaccgctcggcggc
attctgggcgatcagcaggcggccctgttcgggcagacctgcttctcggcgggcgaggcc
aagaacacctacggcaccggctgcttcgcgctgatgaacaccggccccgcgcccgtcgcg
tcgagcgccgggctcatcaccaccgtggcctatcggctcgacgggcgcccgccggcctac
gcgctggagggctccatcgccatcaccggcgccctggtgcagtggctgcgcgacaatctc
gggctgatcggtgcgtcgagcgagatcgaggggctggcccgcagcgttgaggacaatggc
ggcgtctacgtggtgccggcgttttccggcctctacgcgccgcattggcgcgacgacgcc
cgcggcctcatcatcggcctgacccgctacgccaatcgcggccacatcgcccgcgcctgc
ctggaggccaccgcctaccagacccgcgaagttctggaggcgatggagcgcgattccggt
tgtccgatcgccgagttgcgctgcgacggcggcatgaccgtcaacgacctgctgatgcag
ttccaggccgacatcctcgaccggccgaccctgcgcccgaaggtttcggagacgacggcc
ctgggcgcggcctatgccgccggcctcgccacagggttttggaagacactcgaagatctt
cgcgacaactgggccgtggacaagcgctggcatccgcatatccaggcagaagaacgtcgg
gcactgttcgccggctggagccgggccgtagaacgctcgttcggatgggtcgaggagaac
gcttga

DBGET integrated database retrieval system