KEGG   Methylobacterium extorquens PA1: Mext_4125Help
Entry
Mext_4125         CDS       T00640                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_4125
   00030 Pentose phosphate pathway
    Mext_4125
   00051 Fructose and mannose metabolism
    Mext_4125
   00052 Galactose metabolism
    Mext_4125
   00500 Starch and sucrose metabolism
    Mext_4125
   00520 Amino sugar and nucleotide sugar metabolism
    Mext_4125
  Nucleotide metabolism
   00230 Purine metabolism
    Mext_4125
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mext_4125
Enzymes [BR:mex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mext_4125
    5.4.2.8  phosphomannomutase
     Mext_4125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4589778..4591301
Genome map
AA seq 507 aa AA seqDB search
MSFDPSKAFPTPVPKLEPNTFAFEQLPMVKPTGFREYDARWLFPQEINLMGVQALGLGLG
TLIHERGVRPDIVTGHDFRAYSASIKLALIAGMQAAGLRVKDIGLALSPMAYFGQFALDC
PCVAMVTASHNDNGWTGVKMGAERPMTFGPDEMGRLKEIVTTGAFQYRDGGAYEFVSDFA
QVYLDDLVARAKPVSRKLKVVAACGNGTAGAFAPALLERLGVEVIPLDVEPDHSFPRYNP
NPEDMAMLHAIADKVRETGADVGLGFDGDGDRCGVVDDEGEEIFADKIGVMLARDLSKLH
PNATFVVDVKSTGLYAADPELQARGVRTDYWKTGHSYIKRRVNELSALAGFEKSGHFFFN
APVGRGYDDGLLTAIAVIEMLDRNPGQTMADLYRALPKTWGSPTMSPHCADEVKYGVVDA
VTERFRALEASGEPVGGHPITSLVTVNGVRVTTADGTWGLVRASSNKPELVVVVESPVSE
ARLREMFAAVDGVLRQHPEVGAYNQTI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgatccctccaaggcctttcccacgcccgttccgaagcttgagcccaacacc
ttcgccttcgagcagctaccgatggtcaagcccaccggctttcgcgagtacgacgcccgc
tggctgttcccgcaggagatcaacctgatgggcgtccaggcgctcggcctcggcctcggc
acgctgatccatgagcgcggcgtgcgccccgacatcgtcaccggccacgactttcgcgcc
tactccgcctcgatcaagctcgcgctgatcgccgggatgcaggcggcggggctgcgggtg
aaggatatcgggctcgcgctctcgcccatggcctatttcggccaattcgccctcgattgt
ccctgcgtggccatggtcaccgcctcgcacaacgacaacggctggaccggcgtgaagatg
ggggccgagcgcccgatgactttcggccccgacgagatggggcgcctcaaggagatcgtc
accacgggcgcgttccagtaccgcgacggcggcgcctacgaattcgtctccgacttcgct
caggtctatctcgacgacctcgtggcgcgcgccaaacccgtctcgcgaaagctgaaggtc
gtggccgcctgcggcaacggcacggccggcgccttcgcccccgcgcttctggagcggctc
ggcgtcgaggtgatcccgctcgatgtcgagccggatcacagcttcccgcgctacaacccc
aaccccgaggacatggcgatgctgcacgccatcgccgacaaggtgcgcgagaccggcgcc
gatgtcggcctcggcttcgacggcgacggcgaccgctgcggcgtggtcgatgacgagggc
gaggagatctttgccgacaagatcggcgtcatgctggcccgcgacctgtcgaagcttcac
ccgaacgcgaccttcgtggtcgacgtgaaatcgaccggcctctacgccgccgaccccgag
ttgcaggcccgcggcgtgcgcaccgattactggaagacgggccattcctacatcaagcgc
cgcgtcaacgaactctcggcgctggccggcttcgagaagtcgggccacttcttcttcaat
gccccagtcggccgcggctacgacgacggcctgctcacggcgatcgcggtgatcgagatg
ctcgaccgcaacccggggcagaccatggccgacctctaccgggcgctgccgaagacctgg
ggctcgccgaccatgtcgccgcattgcgccgacgaggtgaagtacggcgtggtcgatgcg
gtgaccgagcggttccgggcgctcgaggcgtcgggcgaaccggtgggcggccatcccatc
accagtctcgtgacggtcaacggcgtgcgcgtgaccaccgccgacggcacctgggggctg
gtgcgggcctcctcgaacaagccggaactcgtggtggtggtcgagagcccggtctccgaa
gcgcggcttcgcgagatgttcgcggcggtggatggggtgctgcgccagcacccggaggtg
ggcgcctacaaccagacgatttga

DBGET integrated database retrieval system