KEGG   Methylobacterium extorquens PA1: Mext_4238Help
Entry
Mext_4238         CDS       T00640                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mext_4238
Enzymes [BR:mex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mext_4238
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mext_4238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4717352..4718407
Genome map
AA seq 351 aa AA seqDB search
MSDATPRPLAIETAREAAPGAGPLSLTQRPRRNRKADWSRRLVREHSLTVDDLIWPLFVI
EGEKRREPIASMPGVERLSVDEIVREAERAARLGIPAISFFPYTEPSLRDPTGSEALNRE
NLVCRAVRAVKRAVPEIGVMTDVALDPYTSHGHDGLIEAGAILNDETVAVLVEQSLIQAE
AGTDIIAPSDMMDGRVGAIRTGLDRAGFRDVQIMAYAAKYASAFYGPFRDAIGTSAALVG
DKRTYQMDPGNAAEALREVALDLAEGADSVMVKPGLPYLDIITRVKTEFGVPTFAYQVSG
EYAMIEAAARNGWLDGDRAMTESLLAFKRAGADGVLTYYAPRVAERLRAGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgccaccccgcgcccgctcgccatcgagaccgcgcgcgaagccgcccccggt
gcagggccgctgagcctgacccagcgcccgcgccgcaaccgcaaggcggattggtcgcgc
cgcctcgtgcgcgagcatagcctcaccgtcgatgacctgatctggccgctcttcgtgatc
gagggcgagaagcgccgcgagccgatcgcctccatgcccggcgtcgagcgcctgagcgtg
gacgagatcgtgcgcgaggccgagcgcgccgcgcggctcggcatcccggcgatctcgttc
ttcccctacaccgagccgtccctgcgcgatccgaccggctccgaggcgctgaaccgcgaa
aacctcgtctgccgggcggtgcgggcggtgaagcgggctgttcccgagatcggcgtgatg
accgatgtcgcgctcgacccctataccagccacggccatgacggcttgatcgaagccggc
gccatcctcaacgacgagaccgtggcggtgctggtcgagcagagcctgatccaggccgag
gccggcactgacattatcgccccctccgacatgatggacgggcgcgtcggcgcgatccgc
accggcctcgaccgggccggctttcgcgatgttcagatcatggcctacgccgcgaaatac
gccagcgcgttctacgggccgttccgcgacgccatcggcaccagcgcggcgctggtcggc
gacaagcgcacctaccagatggatcccggcaacgcggccgaggccctgcgcgaggtggcc
ctcgaccttgccgagggcgccgactcggtgatggtcaagcccggcctgccctatctcgac
atcatcacccgcgtgaagacggagttcggcgtgccgaccttcgcctatcaggtgtcgggc
gagtacgcgatgatcgaggccgccgcccgcaacggctggctcgacggcgaccgcgccatg
acggagagcctgctcgccttcaagcgcgcgggcgccgacggggtgctgacctactacgcc
ccccgcgtcgccgagcgcctgcgcgcgggcgcctga

DBGET integrated database retrieval system