KEGG   Methylobacterium extorquens PA1: Mext_4399Help
Entry
Mext_4399         CDS       T00640                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mext_4399
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_4399
   00052 Galactose metabolism
    Mext_4399
   00500 Starch and sucrose metabolism
    Mext_4399
   00520 Amino sugar and nucleotide sugar metabolism
    Mext_4399
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mext_4399
   00524 Butirosin and neomycin biosynthesis
    Mext_4399
Enzymes [BR:mex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mext_4399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4894337..4895338)
Genome map
AA seq 333 aa AA seqDB search
MFEFPVLIGDIGGTNARFGLIETRGAPPRLLSREATHGHPDPSAAIRASLAQGGGPAPRS
AILAIAGRVDAPAVQLTNADWLVDAAAIARDFGLARVALVNDYVPVAAGAAGIAPDDLTP
IGPSRGDASGPRLVLGPGTGFGAAALIPYEDRLAIVSTEAGHTDLGPTDAEEFEIWPAVE
RVEGRVTVETLLSGPGLARICAAIRAVRAGGDGSLCDPAEITSSGLSGEDPHAHAALALF
SKLLGRVCGDLALTFLATGGVYIGGGIAPRIVSVLREGAFREAFERKAPFAEQMRIIPTS
VITVKDPAFSGLAALASESERFVYHGHAWTPQT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaattcccggtgctgatcggcgatatcggcgggaccaatgcccgcttcggcctg
atcgaaacgcggggggcgccgccccgtctcctctcgcgcgaggcgacgcacggccatccc
gatccgagcgcggcgatccgggcctccctggcgcagggcggcgggcccgcgccgcgctcg
gcgatcctggcgatcgcgggccgggtcgatgcgccggcggtccagctcaccaacgcggac
tggctggtggacgcggccgcgatcgcccgcgatttcgggctcgcgcgggtcgcccttgtc
aacgattacgtgccggtcgccgccggcgcggccggcatcgcgcccgacgacctcacgccg
atcggtccaagtcgcggtgacgcaagcgggccgcgcctcgtgctcgggccgggcaccggc
ttcggcgccgccgccctgatcccctacgaggaccgcctcgccatcgtctcgacggaggcc
ggccacaccgatctcgggccgaccgatgcggaggagttcgagatctggccggcggtcgag
cgcgtcgaggggcgggtcacggtggagacgctgctctccggtcccggtctcgcccggatc
tgcgcggcgatccgcgcggtgcgggcgggcggcgacggttcgctgtgcgacccggccgag
atcaccagcagcgggctctcgggcgaggatccgcatgcacacgccgcgctcgcgctgttc
agcaagctgctcggccgggtatgcggggatctggcgctgactttccttgccaccggcggg
gtctatatcggcggcggcatcgccccgcggatcgtctccgtcctgcgggagggcgcgttc
cgcgaggctttcgagcgcaaggcgcccttcgccgagcagatgcgcatcatccccaccagc
gtcatcaccgtgaaggaccccgccttcagcggcctcgcggccctggcgagcgagagcgag
cgcttcgtctatcacgggcatgcctggacgccgcagacgtaa

DBGET integrated database retrieval system