KEGG   Methylobacterium extorquens PA1: Mext_4666Help
Entry
Mext_4666         CDS       T00640                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mext_4666
   01230 Biosynthesis of amino acids
    Mext_4666
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_4666
   00051 Fructose and mannose metabolism
    Mext_4666
   00562 Inositol phosphate metabolism
    Mext_4666
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mext_4666
Enzymes [BR:mex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mext_4666
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mext_4666
  Exosomal proteins of bladder cancer cells
   Mext_4666
  Exosomal proteins of melanoma cells
   Mext_4666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5215045..5215809)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLLSSVPTVEAIRDGLSPALADKIDVLICPPATLISSCVAAVY
GSVVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGADTVIAYEPVWAIGSGRT
PTATEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgctc
tcctcggtcccgaccgtcgaggcgatccgtgacgggctctcgccggcgctcgcggacaag
atcgacgtgctgatctgcccgcccgcgacgctgatctcctcctgcgtggcggcggtctac
ggctccgtggtcgccatcggcggccagaacctgcacgcccggccgagcggcgccttcacc
ggttcgatctcggcggagatgttcgccgatctcggcgccacctacgtcatcgtcggccat
tccgagcggcgcgcctaccattatgagaccgatgacggcgtccacgccaaggcgctcggc
gctcgccgcgcgggcctgcgcggcatcatctgcgtcggcgagacgatggaggagcgccag
cagggccgggcgctcgacatcgtgcgcgcgcagctcgcgatcggcctgccgaagggcgcg
accggcgccgacacggtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgacggagatcgccgaggtccacgcctccttgcgcgagatgctcgacaaactc
gtcggcgaagaggcgcacaagatccgcatcctctacggcggctcggtgaagccgtcgaac
gcccgcgaactgatggcggtggagaacgtcgacggcgcgctggtcggcggcgccagcctc
gtggcggaggactttctggggatctgccgcgcctacgaggggtga

DBGET integrated database retrieval system