KEGG   Methylobacterium extorquens PA1: Mext_4772Help
Entry
Mext_4772         CDS       T00640                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mext_4772
Enzymes [BR:mex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mext_4772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5330989..5331639
Genome map
AA seq 216 aa AA seqDB search
MPTFATRQAMVEAMRRMLDLGLSQGTSGNLSVRTGSGFLVTPSGIPAEQLSPDDLVPMDF
DGHWDHPLAPSSEWRFHRDILAARPEIGAVVHAHPPYATGFAICGREIPAVHYMIAMAGG
PTIRCAPYAPYGTQRLSDFALDALEGRSACLLANHGMIATGPNLSKAMWLAVEVEALCRQ
YAIALQVGAPVVLSDAEVAETVERFKSYGPREKSGH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgccgactttcgcgactcgtcaagcgatggtcgaggcgatgcgccggatgctcgatctc
ggcctcagccagggaacctcgggcaacctctccgtccgaaccggaagcggcttcctcgtg
acgccctccgggattccagcggagcagctcagccccgatgacctcgtccccatggatttc
gacgggcattgggaccatccgctggccccctcttccgagtggcgcttccatcgcgacatc
ctggcggcccggcccgagatcggcgccgtcgtccacgcccatcccccctacgcgaccggt
ttcgcgatctgcgggcgggagatcccggcagtgcattacatgatcgcgatggccggcggc
ccgaccatccgttgcgccccctacgcgccctacggcacgcagcgcctctcggatttcgcc
ctcgacgccctcgaaggccgcagcgcctgcctgcttgccaaccacggcatgatcgccacg
gggccgaacctgtcgaaggcgatgtggctcgccgtcgaagtcgaggccctgtgccgccaa
tatgcgattgcgttgcaggttggcgccccggtcgtgctgtccgatgccgaagtcgccgag
acggtcgagcgattcaagtcctatggccctcgtgagaaatctgggcattga

DBGET integrated database retrieval system