KEGG   Methanocella conradii: Mtc_0102Help
Entry
Mtc_0102          CDS       T01774                                 

Gene name
cofE
Definition
F420-0:gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mez  Methanocella conradii
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mtc_0102 (cofE)
Enzymes [BR:mez01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Mtc_0102 (cofE)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Mtc_0102 (cofE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97865..98680)
Genome map
AA seq 271 aa AA seqDB search
MKITAFTVDGVPMIKEGDDLAEILAGLVKLEDDDIVVFAHTIVSKAEGRRYFLGDIVPTP
RAEELARLNNEDPRFIQHVLNNSTKILMRHPLLVETVWGNVCINAGTDRSNTESGYILSL
PEDPDRSARRLRDRLFELTGKRVAVIITDTNGRSFRVGQIGVAVGCAGIAALRDRRGDKD
LFGHELKITIQAIADEAAACANMLMGEADEGTPIAIIRGYQYLKDDRGIKPSFRTDEEDI
VKKALLEMVEREERAQKAIAHGERPSGVARP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagataaccgcattcacagtggatggcgttccaatgataaaggagggcgacgacctc
gcagaaatcctggcgggcctcgtgaagctagaggacgacgacatagtggtttttgcgcac
accatagtgtcaaaggcggaggggcgcagatactttttaggggacatcgtgcccacgccg
cgggccgaggagctggccaggctgaacaacgaagacccgaggttcatccagcacgtgctc
aataatagcacgaagatactcatgaggcaccccctcctggtcgagacagtgtggggcaac
gtgtgcataaatgccgggactgaccgctcgaacacggaatcagggtacatactatcgctt
ccggaggacccggacaggtcggccaggaggctgagggacaggctcttcgagctgaccggc
aagcgcgtcgccgtcattataaccgacactaacggccgctccttccgggtgggacagata
ggcgtcgccgtgggctgtgccggcatcgcggcgctgcgcgacaggcggggtgacaaagac
ctgtttggccacgagcttaaaatcaccatccaggccatcgcggacgaggccgccgcctgt
gcgaacatgctcatgggcgaggccgacgaggggacgcccatagcgatcatcaggggctat
caatatttgaaggacgataggggcataaagccttctttcaggactgacgaggaggacatc
gtaaagaaggccttgctggaaatggtagagagggaggagcgggctcagaaggctatagcg
cacggggaaaggccttctggcgtagcgaggccctaa

DBGET integrated database retrieval system