KEGG   Methanocella conradii HZ254: Mtc_0190Help
Entry
Mtc_0190          CDS       T01774                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase and related enzyme (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mez  Methanocella conradii HZ254
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mez00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mez00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(179631..180221)
Genome map
AA seq 196 aa AA seqDB search
MITFAELLSLLVASGSLIPLLDKLYICLCQLASWLVVMPQKLIDGVVVKPLRLNVDERGF
LMEVMRPDWETFKKFGQVYVTSAYPGVVKGWHYHKKQWDNFVCVRGMMKVVLYDPRNDSP
TRGVVNEFFIGERNPVQVSIPPYVYHGFKCISTEEALIVNVPTEMYNYEKPDEYRLPPDT
KEIPYDWGLAPGLKHG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgataacctttgcggagcttctatcattattggtagcgtccggctcgcttataccccta
ttagataagctttatatttgtttatgccagttagcttcttggttggttgtaatgcctcag
aagcttattgatggagtcgtggttaagccgcttcgccttaacgttgacgagcgtggtttt
ttaatggaggtcatgcgccctgattgggaaacctttaaaaagttcggccaggtgtacgtt
acctcggcgtatcctggcgtggtgaaggggtggcactatcacaagaagcagtgggataat
ttcgtgtgcgttaggggcatgatgaaggtcgtgctctatgaccccaggaatgattcgcct
actagaggcgtggtaaatgagtttttcattggcgagaggaacccggtgcaggtgagcata
cctccttacgtttaccatgggttcaagtgtataagcaccgaagaagctttaattgtgaac
gtgcccaccgagatgtataactatgaaaagcctgacgagtacaggctgcccccggacacg
aaggagataccttatgactggggcctcgctccagggctaaagcatgggtga

DBGET integrated database retrieval system