KEGG   Methanocella conradii: Mtc_0258Help
Entry
Mtc_0258          CDS       T01774                                 

Gene name
deoA
Definition
(GenBank) putative thymidine phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
mez  Methanocella conradii
Brite
Enzymes [BR:mez01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mtc_0258 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_trans_3N Glycos_transf_3 PYNP_C Molydop_binding HlyD_3 Biotin_lipoyl CDC48_N DUF2254
Motif
Other DBs
NCBI-ProteinID: AFC99029
UniProt: H8I926
Position
complement(256655..258166)
Genome map
AA seq 503 aa AA seqDB search
MKMKAQPYDIEVGRYEIIVNATDADELGIHAGDRVQVKNRDTITAVVETTDAIIPPGRVG
IYREAWEALKTVPDEVVEVIPAERPRSIQYIRKKMDKQKLTSEEMHDIIADIVKGNLTEI
ELTSFVTASYIYGMDADEIEWMTRAMVKTGDQISFDTHPVMDHHSIGGVPGNKISLCVVP
IVAAAGLLIPKTSSRAITGAGGSADLMEILAPVSFSAEEVKKITTKVGGCLVWGGATNIA
PADDKIIGVEYPLSIDPRSQLISSVMAKKYAVGADTMVLDIPMGNQSKIATIQEARKLAR
DFIELGDRLKMRVECAITYGGSPIGRTIGGGLEVREALTMLEKFEGPTSLIEKTLAISGM
MLEMGGVAAKNEGQKMAAEIVKSGKALRKFKEIIEVQGGDPKITSEQVPVGDKVATVLSP
QDGYVLEIFNKRLVAVCRTAGAPHDKGAGILIHKKKGEYVKKGDGLFTIYADKEWKLDAA
IKESLRDPIMFVEGMVLEKVQVV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaggcacagccgtacgacatcgaggtcgggcgatacgagataatagtgaac
gcgacggacgcggacgagctcggcatccacgccggagaccgcgtacaggtcaagaacagg
gatacaataacagcggtagtggagaccacggatgcgatcataccgcccggaagggtggga
atatacagggaggcgtgggaggccctgaaaacggtcccagacgaggtggtcgaggtcatc
cccgcggagcggcccaggtcaatacaatacataaggaaaaagatggataagcagaagctc
accagcgaggagatgcacgacatcatcgccgacatcgtgaagggtaacctcaccgagata
gagctgacctccttcgtcaccgcctcgtacatctacggcatggacgcggacgagatcgag
tggatgaccagggcgatggtgaagacgggcgaccagatatcgttcgacacccatcctgtc
atggaccatcatagcataggcggggtgccaggaaacaagatatcgctgtgcgtcgtgccc
atagtcgctgctgccgggcttctgatacctaagacgagcagccgcgccatcacgggggcg
ggcggaagcgccgacttgatggaaatactggccccggtcagcttcagcgccgaggaagtg
aaaaaaattaccacaaaggtgggcggatgccttgtgtggggcggcgcgacgaacatcgcc
ccggcggacgataagataataggcgtcgagtacccgctctccatcgaccccaggagccag
cttatctcttccgtcatggccaagaagtacgccgtaggggcggacacgatggtgctggac
atcccgatgggcaaccagtccaagatagccaccatacaggaggcgagaaagctggccagg
gatttcatcgagctcggggaccgcctgaagatgcgcgtggagtgcgccataacctacggc
ggctcgcccataggcaggacgataggaggcggcctggaggtgagggaggcgctgaccatg
cttgagaagttcgagggccccacaagcctcatcgagaagaccctcgccatctccggcatg
atgcttgagatgggcggggtggcagctaagaacgagggccagaagatggccgctgagata
gttaagagcggcaaggccctcaggaagttcaaggagataatcgaggtacagggcggtgat
cctaagataacctccgagcaggtgcccgtcggcgacaaggtcgccaccgtcctgtcgccc
caggacggctacgtgctggagatctttaacaagaggcttgtggccgtgtgccgtaccgcc
ggagcgccccatgacaagggggcgggcatattgatacacaagaagaagggcgagtacgtg
aagaagggcgatggcctgtttaccatctacgcagataaggagtggaagctcgacgctgcc
ataaaggagtccttgagggaccccatcatgttcgtcgagggcatggtgctggaaaaggtt
caggttgtataa

DBGET integrated database retrieval system