KEGG   Methanocella conradii: Mtc_0378Help
Entry
Mtc_0378          CDS       T01774                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mez  Methanocella conradii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mtc_0378 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mtc_0378 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mtc_0378 (trpB)
Enzymes [BR:mez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mtc_0378 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
385042..386220
Genome map
AA seq 392 aa AA seqDB search
MAVEGRYGEYGGRYVPEMLVPALQEVEAAYKKYRDDRSFREELDRYLKEYVGRPTPLTPA
RNMSEKYGFKIYLKREDQAFTGAHKINNTMGQALLAKRMGKTRLIAETGAGQHGVATATA
ARALGMKCTIYMGEVDMERQRMNVFRMRLLGAEVVPVRNGTRTLKDAISEAMRAWVTCLD
DTHYLFGTAYGPHPFPAIVRDFQSVIGREARGQILEAEGRLPDAVVACVGGGSNAIGIFS
GFINDKDVRLVGVEAGGCGISSGKHAARFQTGKKGVLHGSYTYVLQDRYGQILDTHSVSA
GLDYAAVGPEHALLRDLGRAEYSYATDDEALSAFQELGMVEGILPALESSHAVAWAIKNR
SDFGEGDVVIINLSGRGDKDVETVARHMGVSV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgagggcaggtatggggaatatggcggcaggtacgtgcccgagatgctcgtg
cccgccctccaggaggtggaggcggcctataaaaaatacagggatgacaggtcgttcagg
gaggagcttgatagatacctaaaggagtatgtgggcaggcccaccccgctcacccccgcg
aggaacatgagcgagaagtacggcttcaagatttatctaaagagggaggaccaggccttc
accggggcgcacaagattaataatacgatggggcaggccctgcttgcgaagcggatgggc
aagacgaggctcatcgcggagacgggggcgggccagcacggcgtggccaccgcgacggcg
gccagggcgctgggcatgaagtgcactatctatatgggcgaggtggacatggagcggcag
aggatgaacgtgttccggatgaggcttctcggcgccgaggtggtgcccgtgaggaacggg
acgcgcacgctgaaggacgcgataagcgaggccatgagggcgtgggtgacctgccttgat
gatactcattacctgtttggcaccgcgtatggcccccacccgttccctgccattgtaagg
gactttcagagcgtcatcggcagggaggcaagggggcagatactcgaggcggaagggcgt
cttccagacgcggtcgtggcctgcgtcgggggcggcagcaacgccataggaatattttcg
ggctttataaatgataaggatgtgcgcctggtaggcgtggaggcgggtggatgcggcata
tcttcgggtaagcacgcagccaggttccagaccggtaagaaaggagtgcttcacggctct
tatacttatgttttgcaggaccgctacgggcagatactggacacgcacagcgtgtccgcg
ggccttgactatgcggccgtcgggcctgagcacgcccttctgagggacctgggacgcgcc
gagtatagctatgccacggatgatgaggccctctccgcctttcaggagctcggcatggtg
gagggcatacttccagcccttgagtcctctcacgcggtggcctgggccattaagaatagg
agcgatttcggggaaggcgacgtggtcatcatcaacctctcagggaggggagataaggac
gtggagaccgtggccaggcacatgggggtgtccgtctga

DBGET integrated database retrieval system