KEGG   Methanocella conradii: Mtc_0379Help
Entry
Mtc_0379          CDS       T01774                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mez  Methanocella conradii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mtc_0379 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mtc_0379 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mtc_0379 (trpA)
Enzymes [BR:mez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mtc_0379 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
386316..387032
Genome map
AA seq 238 aa AA seqDB search
MLAQSLIDSGSVDVLELGIPFSDPIADGPVIQAAVDRALKAGMNTDIAFDLSRRLKKSIP
IVYLTYYNIVLQRGVEKFVGDCADAGVSGIIIADLPFEESRDVRNSCAKYGVDYINIVTP
NTPPGRMRIILEGASGFVYVVSNMGVTGARQSLSIGLRDTVSRTIECANGVPVAVGFGIS
KPAHVSEVIGMGADGAIVGSAIVDMAARKAGVHAILGYVKKLKEGTMPIAPKPGVNVS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcgcagtcgctcatcgattcgggcagcgttgacgtgcttgagcttggcatccct
ttctctgaccccatcgccgacggcccggtgatccaggccgccgttgaccgtgcccttaag
gcgggcatgaacaccgacatcgccttcgacctctcccgtcgattaaagaagagcataccc
atagtctatctaacgtactataatatcgtgcttcagcgcggcgtggaaaaattcgtgggc
gattgcgccgatgcgggcgtctcgggcattatcatcgccgacctgcccttcgaggaaagc
cgtgacgtaagaaattcatgcgcaaaatatggcgttgattacataaacatcgtgacccct
aacacgccgcctggccgtatgagaataatattggagggcgcctccggcttcgtgtacgtc
gtctcgaacatgggcgttaccggcgcccgccagagcctgtccataggcctcagggacaca
gtgtcccgcacgatagagtgcgctaacggggtgcccgttgccgtgggtttcggcatctca
aagccagcacacgttagcgaggtcatcggcatgggcgctgacggggcaatagtgggcagc
gccatagtcgatatggccgccaggaaggccggcgttcacgcaatcctcggctatgtaaaa
aagctgaaggaaggcacaatgcccatcgcgcctaaacctggagttaacgtttcgtga

DBGET integrated database retrieval system