KEGG   Methanocella conradii: Mtc_0382Help
Entry
Mtc_0382          CDS       T01774                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_0382 (tpi)
   01230 Biosynthesis of amino acids
    Mtc_0382 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_0382 (tpi)
   00051 Fructose and mannose metabolism
    Mtc_0382 (tpi)
   00562 Inositol phosphate metabolism
    Mtc_0382 (tpi)
Enzymes [BR:mez01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mtc_0382 (tpi)
Exosome [BR:mez04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mtc_0382 (tpi)
  Exosomal proteins of bladder cancer cells
   Mtc_0382 (tpi)
  Exosomal proteins of melanoma cells
   Mtc_0382 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389234..389893
Genome map
AA seq 219 aa AA seqDB search
MQKPIIILNYKTYLESTGDRGRELTWAARDVMQETGVRIIVCPQTPELFHHKGYGIEVFS
QHIDPIEPGSHTGHVLAQALIHCGVTGSLINHSEDRMPLPDIKKCVEICRKNGLTSVVCA
ESIEKVREVSQLKPDFVAIEPPELIGSGIPVSKADPDIVRDSVKAVTDPEVKVLCGAGIS
KGEDVKAALELGTVGVLLASGVVKAKDPKAALRELVAFK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagccgatcatcatcttgaattataagacttacctggaaagcacgggggacaga
ggcagggagctcacctgggcggccagggacgtcatgcaggagacgggagtgcgtattata
gtatgtcctcaaacgcccgagcttttccaccacaagggatacgggatagaggtcttctcc
cagcacatcgaccccatagagccgggcagccacacgggccacgtgctcgcccaggcactc
atccactgcggggtcacgggctccctcattaaccactcggaagacaggatgcccttgcct
gacataaagaaatgcgtggagatttgccgcaagaacgggctgacctccgtggtgtgcgcc
gaaagcatcgaaaaggtgagggaggtctcgcagcttaagccggacttcgtggccatcgag
cctcctgagcttatcggcagcggcatcccggtatcgaaggccgacccggatatcgtccga
gactctgtaaaggccgtcaccgaccctgaagtgaaggtgctctgtggcgcagggatatct
aagggagaggacgtcaaggcggccctcgagctgggcacggtgggggtccttctagcctcg
ggcgtcgtgaaggctaaggacccgaaggcggcattgagggagctagtcgccttcaaatga

DBGET integrated database retrieval system