KEGG   Methanocella conradii: Mtc_0496Help
Entry
Mtc_0496          CDS       T01774                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mez  Methanocella conradii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mtc_0496
Enzymes [BR:mez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mtc_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493007..493567
Genome map
AA seq 186 aa AA seqDB search
MWREIAYWGRKLAECGLVSSRFGNISVRTERGLLIKRSGAMLDSLKEEDVIEVGLTPSKA
DAGASSETSSHRAIYLATDARAIIHAHPQFAIVESLLCGSEIEPLDSEGLSFLGTIPIVD
GEPGSRELFESLTRAFSSGKARGVVNRGHGSFAAGPDLADCFNTTAMIEHSSKIRYLYDL
QRRAKS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggaaatagcgtattggggtagaaagctggctgaatgcgggctggtcagctcg
aggttcgggaacataagcgttcgaaccgagcgggggctcttaataaagaggtccggcgcc
atgctggactctctcaaagaggaggacgtcatagaggtggggcttaccccttctaaggca
gacgcgggagcgtcctcggagacgtcgagccatcgagccatctacctggccaccgatgcc
agggccatcatccacgcccacccgcagttcgccatagtcgagtcgctgctatgcgggagc
gagatagagccgctcgacagcgaaggcctttcttttttggggacgatacccatcgtcgac
ggagagcctgggtcgagggagcttttcgaaagcttgactcgggcgttctcctcgggcaag
gccaggggcgtggtgaaccgcggccacggctcgttcgccgccgggccggacctcgcggat
tgcttcaacaccacggctatgattgagcacagctcgaagataaggtacctgtacgacctt
cagcggcgcgcaaaaagctag

DBGET integrated database retrieval system