KEGG   Methanocella conradii: Mtc_0841Help
Entry
Mtc_0841          CDS       T01774                                 

Gene name
porD-1
Definition
pyruvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_0841 (porD-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_0841 (porD-1)
   00020 Citrate cycle (TCA cycle)
    Mtc_0841 (porD-1)
   00620 Pyruvate metabolism
    Mtc_0841 (porD-1)
   00640 Propanoate metabolism
    Mtc_0841 (porD-1)
   00650 Butanoate metabolism
    Mtc_0841 (porD-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mtc_0841 (porD-1)
   00680 Methane metabolism
    Mtc_0841 (porD-1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mtc_0841 (porD-1)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mtc_0841 (porD-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
832962..833246
Genome map
AA seq 94 aa AA seqDB search
MAAKEKLTIGLVAKPGGTLGYKTGGWRTFRAVIDHEKCIGCKRCADSCPDGAPYECAHDG
KKKKFCVDYDYCKGCGICAFECPVDAIEMMKEEK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaggagaagttgacaataggcctggtggcgaagcccggcggcacgctgggc
tataagactggcggatggaggacgttcagggcggtcatcgaccacgagaagtgcataggc
tgtaagaggtgcgccgattcctgccccgatggggcgccatacgagtgcgcccacgacggg
aagaaaaagaagttttgcgtcgattatgattattgcaagggatgtggaatttgtgcgttc
gagtgccccgttgacgctatcgaaatgatgaaggaggaaaagtaa

DBGET integrated database retrieval system