KEGG   Methanocella conradii: Mtc_0843Help
Entry
Mtc_0843          CDS       T01774                                 

Gene name
porB-1
Definition
pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_0843 (porB-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_0843 (porB-1)
   00020 Citrate cycle (TCA cycle)
    Mtc_0843 (porB-1)
   00620 Pyruvate metabolism
    Mtc_0843 (porB-1)
   00640 Propanoate metabolism
    Mtc_0843 (porB-1)
   00650 Butanoate metabolism
    Mtc_0843 (porB-1)
  Energy metabolism
   00680 Methane metabolism
    Mtc_0843 (porB-1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mtc_0843 (porB-1)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mtc_0843 (porB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834446..835369
Genome map
AA seq 307 aa AA seqDB search
MAALEDLFASGHRACAGCGCALTLKTLLRVTGPNVIIAQATGCMEVISTPYPESAWKVPW
IHSLFENAAPVAAGIEAGLRATGRKNDTKVIAIGGDGATFDIGFGHLSGVMERGHDILYL
CYDNEAYMNTGIQRSGSTPYDASTTTTPAGKLSFGNQRPKKNLPAIMAAHGVPYVAVTSI
AYPADFTKKVRKALSIEGPKYIQVHATCTPGWGIDSAMSLEVLRLAVETAMYPLFEYENG
QITSVHKIKDRKPVREYLEKQKRFAHLFKMPGGDKEIEKIQRIADLNAEHFGLDVKPKGK
EAAAGKQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctagaagacctgttcgcgtcgggccacagggcctgcgctggctgtggatgc
gccctgacgctgaaaacgctcttgcgcgtcacaggcccgaacgtcataatagcacaggcc
acgggttgcatggaggtcatctcgactccctatcccgagagcgcctggaaagtgccatgg
atacactcgctgttcgagaacgccgcgccggtggcggcgggcatcgaggccgggctgagg
gcgacgggccgtaagaacgacaccaaggtgatagccataggaggcgatggcgccactttc
gatatcggcttcggacacctctccggggtcatggagaggggccacgacatcctatacctg
tgctatgacaacgaggcgtacatgaacaccggcatacagcgaagcggctccaccccgtat
gacgcctccacgacgaccacgccggctggcaagctatccttcggcaaccagaggcccaag
aaaaacctgccggcgataatggcggcgcacggggtgccatacgttgccgtcacctcgata
gcttaccctgcggacttcaccaagaaggtgaggaaagcgttatccatagaagggcctaag
tatattcaggtgcacgcgacgtgcacgcctgggtggggcattgacagcgccatgtccctg
gaggtcctgaggctcgccgtcgagacggccatgtaccccctcttcgagtacgagaacggc
cagattacgagcgtccataagatcaaggatagaaagccggtcagggagtacctggagaag
cagaagcggttcgcccacctcttcaagatgccgggcggcgataaggagatagagaagata
cagcggatagcggaccttaacgccgagcacttcggccttgacgtgaagcctaagggcaag
gaggctgccgccggaaaacagtga

DBGET integrated database retrieval system