KEGG   Methanocella conradii HZ254: Mtc_1223Help
Entry
Mtc_1223          CDS       T01774                                 

Gene name
aor-1
Definition
Aldehyde:ferredoxin oxidoreductase, tungsten containing (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mez  Methanocella conradii HZ254
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mez01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mez00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1187366..1189255
Genome map
AA seq 629 aa AA seqDB search
MKGLWGKLIRANLTNGSVEVERIEDEVARRYPGGKALAAYYAIREIKKGVDPLGPDNMLY
LFTGALTGTPAPLGNRFVAATKSPLTHTFTDSYGGGYWGPELKFAGYDGIILEGVSSEPV
RIHIQDDDIRMMSAKGLWGKDTWETEAEIKRLHGPTKKPLKVLSIGPAGERKDLLAAIIA
DARAAARGGVGAVMGSKNLKAISVLGSKRPPLHDPKTMMLLVKEQNARLNKNPLTAESLR
YRGTANILSMVSEVGALPYRNFSGQQNPGADRISGEAMQKAIWNDGRNWHPCWNCVVKCT
HYHVLEQQGFEGKIDDGPEYETTALLGSNCGINDPKAIALADYLMDGYGLDTISVGDTIS
FLMDCYERGLIGRDMTNGLDLRFGNLDAWMAALNAAGRGEGILGRLVANGCLRAAEEIGH
GSIDFAPQVKGQEIPAYDPRSGQGTALSYARCERGADHLKPWVFGNEWLSYEERTDPFST
ADKPSLVKRESEMSALLDCLCVCRFAANELSLEDDFMLLVNAATGFGYSWHEFREVGERA
VNLARAFGAREGMGRAHDSLPKRFESEPLKEGMAKGNVAKVNDMLSKYYELCGWDENGVP
TPGKLHELGLDFVIGQLKEAGATPQAARA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagggctttggggcaagctgataagggcgaacctgacgaatggcagcgttgaggtg
gagcggatagaggacgaggtggcgaggaggtatcctggcggaaaggcgctggctgcatac
tatgccataagggagataaagaagggcgttgacccgctcgggccggataatatgctatac
cttttcacaggggcgctcacgggcactcctgctccgctgggcaaccgttttgtggcggcc
acgaagtcgcctcttacacatacttttacggattcctacgggggcggctactggggcccc
gagctgaagttcgcgggctacgatggcatcatcctggaaggcgtatcctcggagcccgtg
cgcatccacatacaggatgatgatataaggatgatgagcgcaaaaggcctctggggcaag
gatacctgggagaccgaggcggagattaaaaggttgcatggcccgacgaaaaagcccctg
aaagtattgagcattgggcctgcgggcgagcgtaaggacctgctggcggcgatcatcgca
gacgccagggcggccgcaaggggcggcgtgggggcggtcatgggcagcaagaacctaaag
gcgattagcgtgctcgggagcaagaggcccccgttgcatgacccgaagaccatgatgctc
ctcgtaaaggagcagaacgcccggctcaacaagaaccccttgaccgctgagtccctgcgg
taccgggggacggctaacatcctctccatggtgagcgaggtgggagcgctaccgtacagg
aatttctccggacagcaaaaccccggggcggacaggataagcggggaggcgatgcagaag
gcgatatggaatgatggcaggaactggcacccgtgctggaactgcgtcgtgaagtgcacg
cactaccacgtccttgagcagcagggcttcgagggcaagattgacgacggcccggagtat
gagaccacggctctgctcgggtcgaattgcggcatcaacgacccgaaggccatcgccctg
gctgactacttgatggatggctacggccttgacaccatatccgttggggataccatatca
tttttaatggactgctacgagcgggggcttataggaagggatatgactaacggcctggac
ttgaggtttggcaatctggatgcctggatggccgcactcaacgcggccggaaggggtgag
ggcatcctgggcaggcttgtggcgaacggctgcctcagggcggcagaggagatcggccac
ggaagcatcgatttcgccccgcaggtcaaaggccaggagatccccgcgtatgacccgagg
agcggccagggaaccgcgctttcctacgcgaggtgtgagaggggcgccgaccaccttaag
ccgtgggtttttggcaatgagtggctttcctatgaggagaggactgaccccttctcgacg
gctgataagccgtctctggttaagcgtgaaagcgagatgtctgcgcttctcgactgcctg
tgcgtttgccgttttgccgctaatgagctgagcctggaggatgatttcatgcttctggtg
aatgctgcgactggcttcggctatagttggcacgagttccgtgaggtcggcgagcgggct
gtcaacctcgccagggcgttcggtgcgagggagggcatgggaagggctcatgattcgctg
cctaaaaggtttgagtccgagccgctgaaggagggtatggcgaagggcaacgtggctaaa
gtcaacgacatgctctcgaaatactatgagctgtgtggctgggatgagaatggcgtccct
acgcccgggaagctgcacgagcttggccttgatttcgtcatcggccagctaaaggaggcg
ggcgccaccccgcaggcggcccgcgcctaa

DBGET integrated database retrieval system