KEGG   Methanocella conradii: Mtc_1252Help
Entry
Mtc_1252          CDS       T01774                                 

Gene name
pgm-1
Definition
(GenBank) alpha-phosphoglucomutase / phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mez  Methanocella conradii
Pathway
mez00010  Glycolysis / Gluconeogenesis
mez00030  Pentose phosphate pathway
mez00051  Fructose and mannose metabolism
mez00052  Galactose metabolism
mez00230  Purine metabolism
mez00500  Starch and sucrose metabolism
mez00520  Amino sugar and nucleotide sugar metabolism
mez00521  Streptomycin biosynthesis
mez01100  Metabolic pathways
mez01110  Biosynthesis of secondary metabolites
mez01120  Microbial metabolism in diverse environments
mez01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_1252 (pgm-1)
   00030 Pentose phosphate pathway
    Mtc_1252 (pgm-1)
   00051 Fructose and mannose metabolism
    Mtc_1252 (pgm-1)
   00052 Galactose metabolism
    Mtc_1252 (pgm-1)
   00500 Starch and sucrose metabolism
    Mtc_1252 (pgm-1)
   00520 Amino sugar and nucleotide sugar metabolism
    Mtc_1252 (pgm-1)
  Nucleotide metabolism
   00230 Purine metabolism
    Mtc_1252 (pgm-1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mtc_1252 (pgm-1)
Enzymes [BR:mez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mtc_1252 (pgm-1)
    5.4.2.8  phosphomannomutase
     Mtc_1252 (pgm-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV Methyltransf_29 Asp_protease_2
Motif
Other DBs
NCBI-ProteinID: AFD00006
UniProt: H8I9G1
Position
1217923..1219260
Genome map
AA seq 445 aa AA seqDB search
MALFGTNGVRGVANVELTTDMAMDLAKGFGTFKPGTIAVGRDTRESGEMIKAAVIAGLLS
TGCRVIDLGIAPTPAIQYYVRECGLDGGIVITASHNPPEYNGIKGIASDGTEYSHEDEAV
VESLYYSKEFVRANWSQTGGLSAADPKPMYIDGIISSVDAEAIEAKRFKAVVDTGCGAAS
LTTPFLLRRLGCKVVTINAQVDGTFPGRNPEPTGNEINDLKAAVVAAGADLGVAHDGDAD
RAVFVDEKGRFVNEDVLLAIMAEHILKKKPGSTIVTPVSSSSLIQDIADRYGARVVWTPV
GSIYVARTMMATGAVFGGEGNGGLIFPEFQYCRDGGMSVACMLEMLAHTGKKLSSIVDEM
PAYHSIKDKIRCKDKEAVMKKLAAHVKGEKVDATDGLKIYRPEGWVLIRMSGTEPIIRVF
AESRTESGAKRLAEYGVGLVNEYNK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcattattcgggactaatggcgttagaggcgtggccaacgtagagctgacgaccgac
atggctatggacctggcgaaggggttcgggacatttaagccgggaacgatagctgtcggg
agggatacgagagagtcgggcgagatgatcaaggcggcggtcatcgccggactgctttcg
acgggctgcagggtcatagacctcggaatcgcgcccaccccggccatacagtactacgtc
agggagtgcggcctggacggcggaatagtcatcacggcgtcccataacccgcctgagtat
aacggcattaagggcatagcgagcgatgggaccgagtactcccacgaggacgaggcggtg
gtggagagcctctactattcaaaggagttcgtgagggcgaattggagccagacgggcggc
ctgagcgccgcagaccccaagcccatgtacatcgatggcatcatctccagcgtcgatgct
gaggccatagaggctaaaaggtttaaggccgtcgtggacacgggctgcggcgcggcgagc
ctgaccacgcccttcctgttaagaaggctgggctgtaaggtggtcacgattaacgcccag
gtggacgggactttcccgggcaggaatcccgagccgaccggcaatgagataaacgacttg
aaggcagcggtcgtggccgccggggcggacctgggggttgcccacgatggcgacgccgac
agggccgtgtttgtggacgagaagggcaggttcgtaaacgaggacgtcctgcttgccata
atggccgagcacatattgaaaaagaagccaggcagcacgatcgtaacccccgtaagctcc
tcctccctcatccaggacatagcggataggtatggcgcaagggtcgtctggacgccggtg
ggcagcatttacgtggcgaggaccatgatggccacaggcgccgtcttcgggggcgagggc
aacggcggcctcatcttcccggagttccagtattgccgtgacgggggcatgtccgtcgcc
tgcatgctcgagatgctggcgcacaccggcaagaagctctcatccatagtggacgagatg
cccgcataccatagcatcaaggataagataaggtgtaaggataaggaggccgtcatgaaa
aaattggcggcgcacgtaaagggagagaaggtggacgcgacggacggccttaagatatac
aggccggagggctgggtgttgataaggatgtcgggtaccgagcccatcatcagggttttt
gccgagtccaggaccgaatcgggagctaaaaggcttgccgagtatggggttggcctcgta
aacgagtacaataaatag

DBGET integrated database retrieval system