KEGG   Methanocella conradii: Mtc_1252Help
Entry
Mtc_1252          CDS       T01774                                 

Gene name
pgm-1
Definition
alpha-phosphoglucomutase / phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_1252 (pgm-1)
   00030 Pentose phosphate pathway
    Mtc_1252 (pgm-1)
   00051 Fructose and mannose metabolism
    Mtc_1252 (pgm-1)
   00052 Galactose metabolism
    Mtc_1252 (pgm-1)
   00500 Starch and sucrose metabolism
    Mtc_1252 (pgm-1)
   00520 Amino sugar and nucleotide sugar metabolism
    Mtc_1252 (pgm-1)
  Nucleotide metabolism
   00230 Purine metabolism
    Mtc_1252 (pgm-1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mtc_1252 (pgm-1)
Enzymes [BR:mez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mtc_1252 (pgm-1)
    5.4.2.8  phosphomannomutase
     Mtc_1252 (pgm-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217923..1219260
Genome map
AA seq 445 aa AA seqDB search
MALFGTNGVRGVANVELTTDMAMDLAKGFGTFKPGTIAVGRDTRESGEMIKAAVIAGLLS
TGCRVIDLGIAPTPAIQYYVRECGLDGGIVITASHNPPEYNGIKGIASDGTEYSHEDEAV
VESLYYSKEFVRANWSQTGGLSAADPKPMYIDGIISSVDAEAIEAKRFKAVVDTGCGAAS
LTTPFLLRRLGCKVVTINAQVDGTFPGRNPEPTGNEINDLKAAVVAAGADLGVAHDGDAD
RAVFVDEKGRFVNEDVLLAIMAEHILKKKPGSTIVTPVSSSSLIQDIADRYGARVVWTPV
GSIYVARTMMATGAVFGGEGNGGLIFPEFQYCRDGGMSVACMLEMLAHTGKKLSSIVDEM
PAYHSIKDKIRCKDKEAVMKKLAAHVKGEKVDATDGLKIYRPEGWVLIRMSGTEPIIRVF
AESRTESGAKRLAEYGVGLVNEYNK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcattattcgggactaatggcgttagaggcgtggccaacgtagagctgacgaccgac
atggctatggacctggcgaaggggttcgggacatttaagccgggaacgatagctgtcggg
agggatacgagagagtcgggcgagatgatcaaggcggcggtcatcgccggactgctttcg
acgggctgcagggtcatagacctcggaatcgcgcccaccccggccatacagtactacgtc
agggagtgcggcctggacggcggaatagtcatcacggcgtcccataacccgcctgagtat
aacggcattaagggcatagcgagcgatgggaccgagtactcccacgaggacgaggcggtg
gtggagagcctctactattcaaaggagttcgtgagggcgaattggagccagacgggcggc
ctgagcgccgcagaccccaagcccatgtacatcgatggcatcatctccagcgtcgatgct
gaggccatagaggctaaaaggtttaaggccgtcgtggacacgggctgcggcgcggcgagc
ctgaccacgcccttcctgttaagaaggctgggctgtaaggtggtcacgattaacgcccag
gtggacgggactttcccgggcaggaatcccgagccgaccggcaatgagataaacgacttg
aaggcagcggtcgtggccgccggggcggacctgggggttgcccacgatggcgacgccgac
agggccgtgtttgtggacgagaagggcaggttcgtaaacgaggacgtcctgcttgccata
atggccgagcacatattgaaaaagaagccaggcagcacgatcgtaacccccgtaagctcc
tcctccctcatccaggacatagcggataggtatggcgcaagggtcgtctggacgccggtg
ggcagcatttacgtggcgaggaccatgatggccacaggcgccgtcttcgggggcgagggc
aacggcggcctcatcttcccggagttccagtattgccgtgacgggggcatgtccgtcgcc
tgcatgctcgagatgctggcgcacaccggcaagaagctctcatccatagtggacgagatg
cccgcataccatagcatcaaggataagataaggtgtaaggataaggaggccgtcatgaaa
aaattggcggcgcacgtaaagggagagaaggtggacgcgacggacggccttaagatatac
aggccggagggctgggtgttgataaggatgtcgggtaccgagcccatcatcagggttttt
gccgagtccaggaccgaatcgggagctaaaaggcttgccgagtatggggttggcctcgta
aacgagtacaataaatag

DBGET integrated database retrieval system