KEGG   Methanocella conradii HZ254: Mtc_1470Help
Entry
Mtc_1470          CDS       T01774                                 

Gene name
hdrB-2
Definition
Heterodisulfide reductase, subunit B (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
mez  Methanocella conradii HZ254
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mez01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mez00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395574..1396512
Genome map
AA seq 312 aa AA seqDB search
MLKPQSIPEDNYYLFKSCVTCSIYPGIEKSIRFVLDKIGASYTDDPRHSSCTGFGYHAGV
VPLKTCLALNARNFSLAAESRDSHIACTCPTSYGTLKECKDILSRDPSQREYVEEALKKV
GRNLDLSPSIHHVSEVFLARLEGIRSKAVRDLSGVRAVTHHGCHYSKIYCGDVASGDFER
PTVLDDIAKALGCSVLDYNERSLCCGMGFHYTLVDREYPRSVLKRKLASIKEAGPDVIIT
QCPGCTFNLDYYQENLSNALGPLDIPVMYFSELVAVALGADPYDIGLDMHAVPVEPLLER
LGIAGGERWRQG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcctcaaagcatacccgaggataactattatctattcaagagctgcgtgacg
tgctcgatctatcctggcatcgagaagtcaatacgcttcgtcctggataaaataggggca
agctacaccgatgacccgcgccattcctcatgcacggggttcggataccacgcaggcgtc
gtgccgctaaagacatgcctggcgttaaacgcccgcaacttttccctggccgcggagtcc
agggacagccatatagcctgcacatgcccaacatcatatggaacgcttaaagaatgcaag
gatatcctctcacgagacccatcgcaaagggaatacgttgaagaagccctaaaaaaggtg
ggcagaaatctggacctttccccgagcatccatcacgtctcagaagtttttcttgccagg
ctcgagggcatccggtcgaaggcagtacgtgaccttagcggcgtgagagccgtgacccat
catgggtgccattactctaagatttattgtggagatgtggcctcgggcgacttcgagagg
cccacagtgctagacgacatcgcgaaggccttagggtgtagcgtgctggactataatgag
aggtcgctatgctgcggcatgggattccattatactttagtggaccgtgagtatcccagg
tctgtcctgaagcgtaagctggctagcataaaggaagccggccccgacgtcataattacc
cagtgccctggctgtacttttaacctggactactatcaggagaatctatcgaacgcgttg
ggcccgctggacatccctgtcatgtacttttctgagcttgtggccgtcgcgttgggggca
gacccttatgatatagggctggacatgcacgcggtgccggtagagcccctgcttgagagg
cttggcatcgcgggaggagagcgatggcgccaagggtag

DBGET integrated database retrieval system