KEGG   Methanocella conradii: Mtc_1470Help
Entry
Mtc_1470          CDS       T01774                                 

Gene name
hdrB-2
Definition
Heterodisulfide reductase, subunit B (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
mez  Methanocella conradii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_1470 (hdrB-2)
  Energy metabolism
   00680 Methane metabolism
    Mtc_1470 (hdrB-2)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, acceptors
    1.8.98.1  CoB---CoM heterodisulfide reductase
     Mtc_1470 (hdrB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395574..1396512
Genome map
AA seq 312 aa AA seqDB search
MLKPQSIPEDNYYLFKSCVTCSIYPGIEKSIRFVLDKIGASYTDDPRHSSCTGFGYHAGV
VPLKTCLALNARNFSLAAESRDSHIACTCPTSYGTLKECKDILSRDPSQREYVEEALKKV
GRNLDLSPSIHHVSEVFLARLEGIRSKAVRDLSGVRAVTHHGCHYSKIYCGDVASGDFER
PTVLDDIAKALGCSVLDYNERSLCCGMGFHYTLVDREYPRSVLKRKLASIKEAGPDVIIT
QCPGCTFNLDYYQENLSNALGPLDIPVMYFSELVAVALGADPYDIGLDMHAVPVEPLLER
LGIAGGERWRQG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcctcaaagcatacccgaggataactattatctattcaagagctgcgtgacg
tgctcgatctatcctggcatcgagaagtcaatacgcttcgtcctggataaaataggggca
agctacaccgatgacccgcgccattcctcatgcacggggttcggataccacgcaggcgtc
gtgccgctaaagacatgcctggcgttaaacgcccgcaacttttccctggccgcggagtcc
agggacagccatatagcctgcacatgcccaacatcatatggaacgcttaaagaatgcaag
gatatcctctcacgagacccatcgcaaagggaatacgttgaagaagccctaaaaaaggtg
ggcagaaatctggacctttccccgagcatccatcacgtctcagaagtttttcttgccagg
ctcgagggcatccggtcgaaggcagtacgtgaccttagcggcgtgagagccgtgacccat
catgggtgccattactctaagatttattgtggagatgtggcctcgggcgacttcgagagg
cccacagtgctagacgacatcgcgaaggccttagggtgtagcgtgctggactataatgag
aggtcgctatgctgcggcatgggattccattatactttagtggaccgtgagtatcccagg
tctgtcctgaagcgtaagctggctagcataaaggaagccggccccgacgtcataattacc
cagtgccctggctgtacttttaacctggactactatcaggagaatctatcgaacgcgttg
ggcccgctggacatccctgtcatgtacttttctgagcttgtggccgtcgcgttgggggca
gacccttatgatatagggctggacatgcacgcggtgccggtagagcccctgcttgagagg
cttggcatcgcgggaggagagcgatggcgccaagggtag

DBGET integrated database retrieval system