KEGG   Methanocella conradii: Mtc_1517Help
Entry
Mtc_1517          CDS       T01774                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mez  Methanocella conradii
Pathway
mez00340  Histidine metabolism
mez01100  Metabolic pathways
mez01110  Biosynthesis of secondary metabolites
mez01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mtc_1517 (hisD)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mtc_1517 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFD00270
UniProt: H8I636
Position
1441486..1442760
Genome map
AA seq 424 aa AA seqDB search
MIRQLYGVDDGALEEVFKRRAGISTAMESARRVAEDVRAGGDAAVRKYTKEFDGVELRGL
EVTEDEMYNAVELIDYETIGHLETAIANIEAFHSLQRPAGDMWLTEISPGIRLGQKFTPL
QRVGAYIPGGTASYPSTALMLIVPAKVAGVPEVIACTPPRKDGTVHPLTLAALDMAGADR
VFKVGGVQAIAAMAYGTQSIPRVEKIVGPGNVYVTAAKIYVRDTVEIDMPAGPSEIVVIA
DDTANPSYIAADMIAQAEHDVNAMSILLTPSELLAEAVDIEIEKQKETASRRHIIEKAAM
GIYVVDDIEVAAGVCDRIAPEHVEVMVRDPMLVLNRLHNAGTIYLGEYAPVAAGDYASGA
NHVLPTGGYARVFSGMNTMQFIKTTSVQAIEREGLESIKDTIIALASIEGLDAHARSVSK
RFEQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcagctttatggcgtcgacgacggcgcgctggaggaggtattcaaacgaagg
gccggaatctcaacggcaatggaaagcgcaaggcgggtcgccgaagacgtcagggcggga
ggggacgcggccgtaagaaagtacacaaaagagttcgacggcgtagagctaagaggcctg
gaagtgacagaggatgagatgtacaatgccgtggagctgatagactacgagaccattggc
cacctcgagacggccatcgctaacatagaggcgttccactcgctccagaggcctgcaggg
gacatgtggctcaccgagatatcgccgggaataaggctcggccagaagttcactcccctt
cagcgggttggagcctacattcccggtggaacggcctcatatccttctacggcgctcatg
ctcatagtccccgcgaaggtcgcgggggtgcctgaggttatagcgtgcacgccaccccgc
aaggacggcacggtccatcctttgacccttgcagcgctcgacatggccggggcggaccgc
gtcttcaaggtggggggcgtacaggccatcgcggcgatggcgtacggcacccagagcata
cccagggtggagaagatcgtcgggccgggcaacgtctacgtcacggctgctaaaatttac
gtgcgggacacggtggagatagacatgccggcggggccgagcgagatagtggtcatagcg
gatgacacggcaaatccttcttatatcgccgccgacatgatagcccaggccgagcacgac
gtcaatgcgatgtcaatcctgctgacgccttctgagctgctggctgaggccgtggacatc
gagatagaaaagcaaaaggagaccgcttcgaggagacacatcatcgagaaggcggcgatg
ggcatctacgtggttgacgatatagaggtcgcggcaggggtgtgcgaccgcatcgcccct
gagcacgtcgaggtcatggttcgcgacccgatgctggtgctcaacaggctgcacaacgcg
ggcactatatacctgggcgaatacgcacccgtggcggcgggcgactatgcgagcggcgca
aaccacgtcctgcccaccggcggctatgcgagggttttctcagggatgaatacgatgcag
ttcataaagactaccagcgtccaggccatcgagagggaaggcctggagagcataaaagac
actatcatcgcccttgcgagcatcgagggcttagacgcacacgccaggtcagtttctaag
aggttcgaacaatga

DBGET integrated database retrieval system