KEGG   Methanocella conradii HZ254: Mtc_1517Help
Entry
Mtc_1517          CDS       T01774                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mez  Methanocella conradii HZ254
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mez01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mez00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441486..1442760
Genome map
AA seq 424 aa AA seqDB search
MIRQLYGVDDGALEEVFKRRAGISTAMESARRVAEDVRAGGDAAVRKYTKEFDGVELRGL
EVTEDEMYNAVELIDYETIGHLETAIANIEAFHSLQRPAGDMWLTEISPGIRLGQKFTPL
QRVGAYIPGGTASYPSTALMLIVPAKVAGVPEVIACTPPRKDGTVHPLTLAALDMAGADR
VFKVGGVQAIAAMAYGTQSIPRVEKIVGPGNVYVTAAKIYVRDTVEIDMPAGPSEIVVIA
DDTANPSYIAADMIAQAEHDVNAMSILLTPSELLAEAVDIEIEKQKETASRRHIIEKAAM
GIYVVDDIEVAAGVCDRIAPEHVEVMVRDPMLVLNRLHNAGTIYLGEYAPVAAGDYASGA
NHVLPTGGYARVFSGMNTMQFIKTTSVQAIEREGLESIKDTIIALASIEGLDAHARSVSK
RFEQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcagctttatggcgtcgacgacggcgcgctggaggaggtattcaaacgaagg
gccggaatctcaacggcaatggaaagcgcaaggcgggtcgccgaagacgtcagggcggga
ggggacgcggccgtaagaaagtacacaaaagagttcgacggcgtagagctaagaggcctg
gaagtgacagaggatgagatgtacaatgccgtggagctgatagactacgagaccattggc
cacctcgagacggccatcgctaacatagaggcgttccactcgctccagaggcctgcaggg
gacatgtggctcaccgagatatcgccgggaataaggctcggccagaagttcactcccctt
cagcgggttggagcctacattcccggtggaacggcctcatatccttctacggcgctcatg
ctcatagtccccgcgaaggtcgcgggggtgcctgaggttatagcgtgcacgccaccccgc
aaggacggcacggtccatcctttgacccttgcagcgctcgacatggccggggcggaccgc
gtcttcaaggtggggggcgtacaggccatcgcggcgatggcgtacggcacccagagcata
cccagggtggagaagatcgtcgggccgggcaacgtctacgtcacggctgctaaaatttac
gtgcgggacacggtggagatagacatgccggcggggccgagcgagatagtggtcatagcg
gatgacacggcaaatccttcttatatcgccgccgacatgatagcccaggccgagcacgac
gtcaatgcgatgtcaatcctgctgacgccttctgagctgctggctgaggccgtggacatc
gagatagaaaagcaaaaggagaccgcttcgaggagacacatcatcgagaaggcggcgatg
ggcatctacgtggttgacgatatagaggtcgcggcaggggtgtgcgaccgcatcgcccct
gagcacgtcgaggtcatggttcgcgacccgatgctggtgctcaacaggctgcacaacgcg
ggcactatatacctgggcgaatacgcacccgtggcggcgggcgactatgcgagcggcgca
aaccacgtcctgcccaccggcggctatgcgagggttttctcagggatgaatacgatgcag
ttcataaagactaccagcgtccaggccatcgagagggaaggcctggagagcataaaagac
actatcatcgcccttgcgagcatcgagggcttagacgcacacgccaggtcagtttctaag
aggttcgaacaatga

DBGET integrated database retrieval system