KEGG   Methanocella conradii: Mtc_1520Help
Entry
Mtc_1520          CDS       T01774                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mez  Methanocella conradii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mtc_1520
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mtc_1520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mtc_1520
Enzymes [BR:mez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mtc_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444820..1446154
Genome map
AA seq 444 aa AA seqDB search
MADNSEAKAREAIKVTLDVDEIPKKWYNIVADIPGGLPPALHPGTKEPLKPSEWEAIFPK
GLIRQELSTERFIDVPDEVREALARIGRPTPLYRASRLEKALGTPARIYYKREDLSPTGS
HKPNTAIAQAYFNFIEGVDHLTTETGAGQWGSALSSAAAYFGMKCTVFMVKSSYDQKPYR
KYVMKLYGADVYASPSDRTEFGRKTLEKDPGCAGSLGIAISEAIELAVNSPNTKYSLGSV
LNHVMLHQTVIGQEAQKQLAMIDEKPDKMIACVGGGSNFAGFTFPFIYEKLKGKNDARFI
AVEPESVPSLTGIKSGRSRYDYDFGDTAGMTPLLKMYTLGHDFMPDPIHAGGLRYHGMAP
TVSALYDKGIIDAEALPQDETFVAGELFTRTEGIIPAPESCHAIASAIRHARECKRLNKE
EVIVFNLSGHGLLDLQNYATMLGM
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatagcgaggcaaaggcgagagaggccataaaggtcacgctggacgtagac
gagatcccgaagaagtggtacaacatcgtggcggatataccgggtggattgcctcccgct
ttacaccccgggactaaagagccgctaaagccttcagagtgggaggccattttccctaag
gggcttatcaggcaggagctctccaccgagcgcttcatcgacgtgcctgacgaggtgagg
gaggcccttgccaggataggcaggccgacgccgctgtatcgcgcctctcgcctggaaaag
gccctgggcacgcctgcgagaatatactataagcgggaggacctctccccaactggctca
cataagcctaacactgcgatagcgcaggcatactttaactttatcgagggcgtcgaccac
ctcacgaccgagacgggggcgggccagtggggctccgccttgagctccgctgcagcttac
tttggcatgaagtgtacggtatttatggtaaaatcctcctatgaccagaagccatacagg
aagtacgtcatgaagctgtacggtgccgacgtttacgcctcgccaagcgaccgcaccgag
ttcgggagaaaaacgctggaaaaagacccgggctgtgcgggaagcctgggcatagctatc
agcgaggccatagagctcgcagtcaatagccccaacaccaagtactcgctgggcagcgtg
ctcaaccacgtcatgcttcaccagactgtcatcggccaggaagcccagaagcagctcgcc
atgatagacgagaagcctgataagatgatagcctgcgtgggcggcggaagcaacttcgcg
ggcttcacgtttccattcatatacgaaaagctcaaaggcaagaacgacgcccgtttcatc
gccgtcgagcccgagagcgtcccctcgttgacggggattaagagtggcaggtcaaggtat
gattatgacttcggggacaccgcaggcatgaccccccttcttaagatgtacacgctaggc
cacgacttcatgcccgatcccatccacgcaggaggcttaaggtaccatggcatggccccg
accgtgtccgccctctacgataagggcatcatagatgccgaggccctgccccaggatgag
accttcgtcgcgggcgagcttttcacccgcacggagggcataatacccgcgcccgagtcc
tgccacgccatagcctcggccattcggcacgccagggagtgcaagcgccttaataaagaa
gaggtgatagtcttcaacctgagtggccacgggctgcttgacctacagaattatgcgacg
atgcttggcatgtaa

DBGET integrated database retrieval system