KEGG   Methanocella conradii: Mtc_1520Help
Entry
Mtc_1520          CDS       T01774                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mez  Methanocella conradii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mtc_1520
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mtc_1520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mtc_1520
Enzymes [BR:mez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mtc_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1444820..1446154
Genome map
AA seq 444 aa AA seqDB search
MADNSEAKAREAIKVTLDVDEIPKKWYNIVADIPGGLPPALHPGTKEPLKPSEWEAIFPK
GLIRQELSTERFIDVPDEVREALARIGRPTPLYRASRLEKALGTPARIYYKREDLSPTGS
HKPNTAIAQAYFNFIEGVDHLTTETGAGQWGSALSSAAAYFGMKCTVFMVKSSYDQKPYR
KYVMKLYGADVYASPSDRTEFGRKTLEKDPGCAGSLGIAISEAIELAVNSPNTKYSLGSV
LNHVMLHQTVIGQEAQKQLAMIDEKPDKMIACVGGGSNFAGFTFPFIYEKLKGKNDARFI
AVEPESVPSLTGIKSGRSRYDYDFGDTAGMTPLLKMYTLGHDFMPDPIHAGGLRYHGMAP
TVSALYDKGIIDAEALPQDETFVAGELFTRTEGIIPAPESCHAIASAIRHARECKRLNKE
EVIVFNLSGHGLLDLQNYATMLGM
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatagcgaggcaaaggcgagagaggccataaaggtcacgctggacgtagac
gagatcccgaagaagtggtacaacatcgtggcggatataccgggtggattgcctcccgct
ttacaccccgggactaaagagccgctaaagccttcagagtgggaggccattttccctaag
gggcttatcaggcaggagctctccaccgagcgcttcatcgacgtgcctgacgaggtgagg
gaggcccttgccaggataggcaggccgacgccgctgtatcgcgcctctcgcctggaaaag
gccctgggcacgcctgcgagaatatactataagcgggaggacctctccccaactggctca
cataagcctaacactgcgatagcgcaggcatactttaactttatcgagggcgtcgaccac
ctcacgaccgagacgggggcgggccagtggggctccgccttgagctccgctgcagcttac
tttggcatgaagtgtacggtatttatggtaaaatcctcctatgaccagaagccatacagg
aagtacgtcatgaagctgtacggtgccgacgtttacgcctcgccaagcgaccgcaccgag
ttcgggagaaaaacgctggaaaaagacccgggctgtgcgggaagcctgggcatagctatc
agcgaggccatagagctcgcagtcaatagccccaacaccaagtactcgctgggcagcgtg
ctcaaccacgtcatgcttcaccagactgtcatcggccaggaagcccagaagcagctcgcc
atgatagacgagaagcctgataagatgatagcctgcgtgggcggcggaagcaacttcgcg
ggcttcacgtttccattcatatacgaaaagctcaaaggcaagaacgacgcccgtttcatc
gccgtcgagcccgagagcgtcccctcgttgacggggattaagagtggcaggtcaaggtat
gattatgacttcggggacaccgcaggcatgaccccccttcttaagatgtacacgctaggc
cacgacttcatgcccgatcccatccacgcaggaggcttaaggtaccatggcatggccccg
accgtgtccgccctctacgataagggcatcatagatgccgaggccctgccccaggatgag
accttcgtcgcgggcgagcttttcacccgcacggagggcataatacccgcgcccgagtcc
tgccacgccatagcctcggccattcggcacgccagggagtgcaagcgccttaataaagaa
gaggtgatagtcttcaacctgagtggccacgggctgcttgacctacagaattatgcgacg
atgcttggcatgtaa

DBGET integrated database retrieval system