KEGG   Methanocella conradii: Mtc_1593Help
Entry
Mtc_1593          CDS       T01774                                 

Gene name
pfkA-1
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mez  Methanocella conradii
Pathway
mez00010  Glycolysis / Gluconeogenesis
mez00030  Pentose phosphate pathway
mez00051  Fructose and mannose metabolism
mez00052  Galactose metabolism
mez00680  Methane metabolism
mez01100  Metabolic pathways
mez01110  Biosynthesis of secondary metabolites
mez01120  Microbial metabolism in diverse environments
mez01130  Biosynthesis of antibiotics
mez01200  Carbon metabolism
mez01230  Biosynthesis of amino acids
mez03018  RNA degradation
Module
mez_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_1593 (pfkA-1)
   00030 Pentose phosphate pathway
    Mtc_1593 (pfkA-1)
   00051 Fructose and mannose metabolism
    Mtc_1593 (pfkA-1)
   00052 Galactose metabolism
    Mtc_1593 (pfkA-1)
  Energy metabolism
   00680 Methane metabolism
    Mtc_1593 (pfkA-1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mtc_1593 (pfkA-1)
Enzymes [BR:mez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mtc_1593 (pfkA-1)
Protein phosphatases and associated proteins [BR:mez01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mtc_1593 (pfkA-1)
Messenger RNA biogenesis [BR:mez03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mtc_1593 (pfkA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFD00345
UniProt: H8I7U5
Position
complement(1515397..1516383)
Genome map
AA seq 328 aa AA seqDB search
MSFFIGVSLKTIGIVTSGGDAPGMNAAIRAVTRIASYRGFKVLGFERGWEGLISNFVRPL
TPRSVSGIIQLGGTILHTTRCPRMETPEGMEKAVDCLASNGVDGLVVIGGDGSFRAALAL
SERTDTLIVGVPATIDNDVAGTDETIGFDTAVNTAVQEIDKIRDTAISHERIFIVEVMGR
KRGFLAAMVGLTVGAEIILVPEVPFKAEKVFNTIKDNAAKGKRSAIIVAAEGIGDTKKLA
LDIEKNTGLETRLSILGYAQRGGSPTARSRYLAGELGNKAVEIISEENGGQVACLQNGVI
TSIDLKTTCSMEKPLDLRLLKLADILAT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgtcattctttattggggtttcattgaagaccatcggcatcgtgacgagcggcggcgac
gcgccgggcatgaacgctgctataagggcagtcacgcggattgcgagctaccgcggcttc
aaggtgcttggatttgagcgaggctgggagggccttatctcaaacttcgtgaggcctttg
acgccgagatcggtcagcggcatcatacaattagggggtactatactccatacgacgagg
tgtccgcgcatggagacgcccgagggcatggagaaagccgtcgattgcctcgcctccaat
ggcgtggatggcctggtggtcatcggaggcgacgggtctttcagggcggccttagcgtta
agcgaaaggaccgatactctaatcgtgggggtgccggcgaccatcgacaacgacgtggcg
gggacggatgagaccataggttttgacacggcggtgaacacggccgtccaggaaatcgat
aagataagggacacggcaatatcacatgaaaggatttttatcgtagaagtgatgggccgc
aaaagaggatttttagcggcaatggtaggccttacagtaggcgccgagatcatactggtg
cccgaggtcccatttaaagccgaaaaagtcttcaacactattaaagataatgcggccaag
gggaaacggtcggccataattgtcgccgccgagggcataggggacacgaaaaagctcgcc
cttgacatagaaaaaaacacgggattggagaccaggctgagcattttaggctatgcccag
cgagggggtagccctacggcaagaagccgctacctggcaggagagctcggcaacaaagcc
gtagagataatctccgaggaaaatgggggccaggtggcttgccttcaaaatggggtcatt
acgagcatagacctcaaaacaacatgcagcatggagaaacccctggaccttcgtttgctc
aagcttgcggacatccttgcgacatga

DBGET integrated database retrieval system